Recombinant Xenopus tropicalis Transmembrane protein 218 (tmem218)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant TMEM218 is synthesized using E. coli expression systems, optimized for high yield and stability:

  • Expression Vector: pET-based plasmids with T7 promoters

  • Purification: Nickel-affinity chromatography via His-tag

  • Purity: >85% (SDS-PAGE verified)

Functional Insights

TMEM218 is implicated in ciliary function and genetic disorders:

  • Cellular Role: Localizes to cilia and membranes; regulates ciliary assembly .

  • Disease Associations:

    • Joubert Syndrome: Mutations in human TMEM218 disrupt cerebellar development .

    • Senior-Loken Syndrome: Linked to renal-retinal ciliopathies in rat models .

  • Protein Interactions: Binds to PDE2A and OLR1, modulating signal transduction .

Genetic Studies in Xenopus tropicalis

  • Forward Genetic Screens: Used to identify mutations affecting organogenesis .

  • Evolutionary Analysis: Synteny with mammalian genomes aids in studying vertebrate evolution .

Biomedical Applications

  • Ciliopathy Models: TMEM218 knockdown in Xenopus embryos mimics human ciliary disorders .

  • Drug Discovery: Target for small molecules regulating ciliary signaling .

Handling and Stability

  • Reconstitution: Lyophilized protein requires sterile water + 50% glycerol .

  • Shelf Life:

    • Liquid: 6 months at -20°C/-80°C

    • Lyophilized: 12 months at -20°C/-80°C

  • Stability Note: Avoid repeated freeze-thaw cycles; aliquot for single-use .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve transmembrane topology .

  • CRISPR/Cas9 Models: Generating Xenopus tropicalis TMEM218 knockouts for phenotypic analysis .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will prepare it according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
tmem218; Transmembrane protein 218
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem218
Target Protein Sequence
MATTILGVGPGVFIIAVIWMVTLMLTVLLCRASGKARFWTVVVFTLALITTLILVFFPRA SQTPAPAKEMQIVDTFFIGRYFLISIMSVIFLGCLFFVFVYHILEPVYAKPIGIH
Uniprot No.

Target Background

Function
May be involved in ciliary biogenesis or function.
Database Links
Protein Families
TMEM218 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is Transmembrane Protein 218 (TMEM218) and what is its significance in Xenopus tropicalis research?

TMEM218 is a transmembrane protein that plays critical roles in kidney and eye development. Research using TMEM218 knockout models has revealed its importance in preventing renal cyst development and retinal degeneration. Xenopus tropicalis serves as an excellent model organism for studying TMEM218 function due to its well-characterized genome and developmental processes, making it valuable for investigating the protein's role in vertebrate development and disease models . While many studies have focused on mouse models, the conservation of TMEM218 across vertebrates makes Xenopus tropicalis an important comparative model for understanding evolutionary conservation of function.

How is the expression pattern of TMEM218 characterized in Xenopus tropicalis?

TMEM218 expression can be characterized using β-galactosidase enzyme histochemistry in knockout models where the LacZ reporter gene replaces the TMEM218 gene. This technique reveals that TMEM218 is expressed in multiple cell types, including renal epithelium, retina, various ciliated/flagellated cells (respiratory epithelium, ependymal and choroid plexus cells), reproductive tract cells (vas deferens, epididymis, and spermatids), and several endocrine cell types (pancreatic islets, pituitary gland, adrenal medulla, parathyroid gland, and C-cells of thyroid gland) . This expression pattern suggests TMEM218 may have diverse functions in different tissues, with particularly important roles in ciliated epithelial cells.

What are the primary phenotypes observed in TMEM218 knockout models?

TMEM218 knockout models demonstrate two major phenotypes:

  • Progressive cystic kidney disease characterized by:

    • Tubular atrophy with tubulointerstitial inflammatory cell infiltrates

    • Interstitial fibrosis

    • Disruption, thickening, and splitting of tubular basement membranes

    • Diffuse renal cyst development in essentially normal-sized kidneys

  • Retinal degeneration characterized by:

    • Slow-onset loss of photoreceptors

    • Diffuse thinning of the outer nuclear layer

    • Reduced electroretinogram (ERG) responses

    • Preservation of inner retinal layers

These phenotypes emerge progressively, with kidney function typically becoming impaired by approximately 17 weeks of age, and retinal degeneration becoming pronounced by 29 weeks in mouse models.

What is the recommended protocol for expressing recombinant Xenopus tropicalis TMEM218 protein?

Based on similar recombinant protein expression systems used for Xenopus tropicalis proteins, the following protocol is recommended:

  • Clone the full-length Xenopus tropicalis TMEM218 coding sequence (or specific domains of interest) into an appropriate expression vector with an N-terminal or C-terminal His-tag

  • Transform the construct into E. coli expression strains (BL21(DE3) or similar)

  • Induce protein expression using IPTG at optimal concentrations (typically 0.1-1.0 mM)

  • Harvest and lyse cells under conditions that preserve protein structure

  • Purify the recombinant protein using Ni-NTA affinity chromatography

  • Perform quality control via SDS-PAGE to ensure purity greater than 90%

  • Lyophilize the purified protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for long-term storage.

How can researchers effectively design CRISPR/Cas9 knockout strategies for TMEM218 in Xenopus tropicalis?

To design effective CRISPR/Cas9 knockout strategies for TMEM218 in Xenopus tropicalis:

  • Target Selection:

    • Identify highly conserved regions in the early coding exons of TMEM218

    • Select target sites with minimal off-target potential using algorithms like CRISPOR or CHOPCHOP

    • Design 2-3 gRNAs targeting different exons to increase knockout efficiency

  • Microinjection Protocol:

    • Inject 1-2 ng Cas9 protein with 500 pg of each gRNA into one-cell stage embryos

    • Include a tracer dye (e.g., rhodamine dextran) to verify successful injection

    • Maintain control groups of uninjected embryos and Cas9-only injected embryos

  • Verification Strategy:

    • Perform T7 endonuclease I assay or direct sequencing on a subset of injected embryos at stages 18-20 to confirm mutagenesis

    • Rear remaining embryos to adulthood for founder generation

    • Screen F1 progeny for germline transmission using fin clip genotyping

  • Phenotypic Analysis:

    • Monitor kidney function through urine volume and osmolality measurements

    • Examine retinal structure through histology and function through electroretinography

    • Conduct comparative analysis with wild-type siblings

This approach has been successfully used to generate knockout lines in Xenopus tropicalis for other genes like slc2a7.

What controls should be included when analyzing the effects of TMEM218 mutations on kidney function in Xenopus tropicalis?

When analyzing kidney function in TMEM218 mutant Xenopus tropicalis, the following controls should be included:

  • Genetic Controls:

    • Wild-type (+/+) littermates as negative controls

    • Heterozygous (+/-) littermates to assess potential haploinsufficiency effects

    • Known kidney disease mutants (if available) as positive controls

  • Physiological Parameter Controls:

    • Age-matched controls, as kidney phenotypes develop progressively

    • Gender-matched controls, as male and female kidney parameters may differ

    • Body weight measurements to normalize kidney function metrics

  • Functional Assays:

    • 24-hour urine collection with measurements of:

      • Volume (ml)

      • Creatinine levels (mg)

      • Osmolality (mOsm/kg H₂O)

    • Serum analysis for:

      • Creatinine

      • Blood urea nitrogen

      • Electrolytes (chloride, calcium)

      • Alkaline phosphatase

  • Histological Controls:

    • Multiple anatomical regions (cortex, medulla) should be examined

    • Multiple time points to track progressive changes

    • Specialized staining for basement membranes and fibrosis

This comprehensive control strategy allows for robust assessment of kidney phenotypes resulting from TMEM218 mutations.

How does TMEM218 function relate to ciliopathies, and what experimental approaches can be used to investigate this relationship?

TMEM218's potential role in ciliopathies can be investigated through several experimental approaches:

  • Structural Localization Studies:

    • Perform immunofluorescence co-localization of TMEM218 with ciliary markers (acetylated tubulin, IFT proteins)

    • Use super-resolution microscopy to determine precise subcellular localization

    • Conduct immuno-EM studies to visualize TMEM218 at the ultrastructural level

  • Functional Interaction Analyses:

    • Perform co-immunoprecipitation to identify TMEM218 binding partners

    • Use proximity labeling techniques (BioID, APEX) to identify the TMEM218 interactome

    • Create compound mutants with known ciliopathy genes to assess genetic interactions

  • Ciliary Function Assays:

    • Measure ciliary length and morphology in TMEM218-deficient cells

    • Assess ciliary signaling pathways (Hedgehog, Wnt, etc.)

    • Analyze intraflagellar transport (IFT) dynamics using live imaging

  • Disease Modeling:

    • Compare TMEM218 knockout phenotypes with human nephronophthisis and retinitis pigmentosa

    • Screen patient cohorts with unexplained Senior-Løken syndrome for TMEM218 mutations

    • Create patient-specific mutations in Xenopus tropicalis using precise genome editing

The phenotypic resemblance between TMEM218 knockout animals and human ciliopathies suggests TMEM218 may be a candidate gene for Senior-Løken syndrome cases that remain genetically unresolved (approximately 70% of cases).

What methodological approaches can address the contradictory data regarding TMEM218's role in different vertebrate models?

To resolve contradictory data regarding TMEM218's role across vertebrate models:

  • Cross-Species Comparative Analysis:

    • Perform rigorous sequence and structural analysis of TMEM218 orthologs

    • Create species-specific antibodies to ensure accurate protein detection

    • Compare expression patterns using standardized methodology across species

  • Functional Rescue Experiments:

    • Conduct cross-species rescue experiments (e.g., express Xenopus TMEM218 in mouse knockout models)

    • Create chimeric proteins with domains from different species to identify critical functional regions

    • Use inducible expression systems to test temporal requirements

  • Methodological Standardization:

    • Standardize knockout strategies (e.g., targeting the same relative exons)

    • Use consistent phenotypic assays and developmental time points

    • Implement blinded analysis of phenotypes to reduce investigator bias

  • Multi-omics Integration:

    • Compare transcriptome changes in TMEM218-deficient tissues across species

    • Analyze proteome alterations to identify conserved vs. divergent pathways

    • Investigate potential species-specific genetic modifiers through QTL analysis

This multi-faceted approach can help distinguish genuine species-specific differences from methodological variations or genetic background effects.

How can the electroretinogram (ERG) methodology be optimized for detecting early retinal degeneration in TMEM218-deficient Xenopus tropicalis?

To optimize ERG methodology for detecting early retinal degeneration in TMEM218-deficient Xenopus tropicalis:

  • Technical Optimization:

    • Use custom-sized electrodes appropriate for Xenopus tropicalis eyes

    • Implement dark adaptation protocols of 8-12 hours prior to testing

    • Adjust stimulus parameters to include multiple light intensities (0.006, 0.04, and 24 cd.s/m²) to detect subtle changes

    • Record both a-wave and b-wave responses to assess photoreceptor and inner retinal function respectively

  • Age-Dependent Analysis:

    • Begin testing at 2 months of age before histological changes appear

    • Perform longitudinal testing at 1-month intervals to track progression

    • Calculate rate of decline for individual animals to account for variability

  • Advanced ERG Protocols:

    • Implement flicker ERG protocols to assess cone-specific function

    • Use scotopic threshold response measurements for early rod dysfunction detection

    • Add oscillatory potential analysis to evaluate inner retinal circuitry

    • Include photopic negative response to assess retinal ganglion cell function

  • Data Analysis Refinements:

    • Analyze implicit time shifts which may precede amplitude reductions

    • Apply Fourier analysis to identify subtle waveform changes

    • Use normalization procedures based on baseline recordings

    • Implement statistical approaches that account for longitudinal data structure

Based on published data, early detection of retinal degeneration in TMEM218-deficient animals should focus on a-wave responses at high light intensities (24 cd.s/m²), as these show the earliest significant changes before obvious histological alterations.

What methodological approaches can determine if TMEM218 mutations contribute to human Senior-Løken syndrome?

To investigate TMEM218's potential role in human Senior-Løken syndrome:

  • Genetic Screening Approach:

    • Perform targeted sequencing of TMEM218 in genetically unresolved Senior-Løken syndrome patients

    • Conduct whole-exome sequencing with prioritization of TMEM218 and interacting genes

    • Use segregation analysis in affected families to confirm pathogenicity

    • Apply ACMG guidelines for variant classification

  • Functional Characterization:

    • Create patient-specific mutations in cell models using CRISPR/Cas9

    • Develop induced pluripotent stem cell (iPSC) models from patient samples

    • Differentiate iPSCs into renal organoids and retinal organoids to study disease mechanisms

    • Perform rescue experiments with wild-type TMEM218

  • Animal Model Validation:

    • Generate human mutation-specific knockin models in Xenopus tropicalis

    • Compare phenotypes between human patients and animal models

    • Test therapeutic approaches in animal models before clinical application

  • Population Studies:

    • Calculate the prevalence of TMEM218 variants in different populations

    • Identify potential genetic modifiers through GWAS in large cohorts

    • Develop genetic risk scores incorporating TMEM218 and related genes

Since mutations in known nephronophthisis genes account for only about 30% of cases, TMEM218 represents a candidate gene for the remaining unexplained cases, particularly those with concurrent retinal degeneration.

How can researchers characterize the molecular pathways downstream of TMEM218 in renal and retinal tissues?

To characterize molecular pathways downstream of TMEM218:

  • Transcriptomic Analysis:

    • Perform RNA-seq on isolated tissues from wild-type and TMEM218-deficient animals at multiple time points

    • Use single-cell RNA-seq to identify cell type-specific responses

    • Apply trajectory analysis to map disease progression at the molecular level

    • Validate key differentially expressed genes using qRT-PCR and in situ hybridization

  • Proteomic and Post-translational Modification Studies:

    • Conduct comparative proteomics on affected tissues

    • Analyze phosphoproteome changes to identify altered signaling pathways

    • Examine ubiquitination and other post-translational modifications

    • Perform spatial proteomics to localize protein changes

  • Signaling Pathway Analysis:

    • Assess canonical ciliary signaling pathways (Hedgehog, Wnt, etc.)

    • Investigate inflammatory and fibrotic pathways in kidney tissue

    • Examine apoptotic and stress response pathways in photoreceptors

    • Test pathway inhibitors/activators to validate causality

  • Integrative Multi-omics:

    • Combine data from genomic, transcriptomic, and proteomic analyses

    • Use computational approaches to identify regulatory networks

    • Validate key nodes using targeted genetic manipulation

    • Develop pathway maps specific to TMEM218 function

This comprehensive approach can reveal the molecular mechanisms by which TMEM218 deficiency leads to the observed phenotypes and identify potential therapeutic targets.

What are the optimal methods for analyzing TMEM218 expression patterns in Xenopus tropicalis embryonic development?

To optimally analyze TMEM218 expression during Xenopus tropicalis development:

  • Temporal Expression Analysis:

    • Perform quantitative RT-PCR at defined developmental stages (from blastula to tadpole)

    • Use digital droplet PCR for absolute quantification of low-abundance transcripts

    • Conduct RNA-seq at key developmental transitions

    • Analyze protein expression via Western blotting with stage-specific samples

  • Spatial Expression Analysis:

    • Implement whole-mount in situ hybridization with TMEM218-specific probes

    • Use fluorescent in situ hybridization for co-localization studies

    • Perform immunohistochemistry with validated TMEM218 antibodies

    • Create transgenic reporter lines (TMEM218:GFP) for live imaging studies

  • Single-Cell Resolution:

    • Apply single-cell RNA-seq to map expression in specific lineages

    • Use laser capture microdissection to isolate specific tissues for analysis

    • Implement spatial transcriptomics to preserve tissue context

    • Conduct multiplexed RNA-scope assays for co-expression studies

  • Functional Regulation Studies:

    • Analyze promoter and enhancer elements using reporter assays

    • Identify transcription factors binding to TMEM218 regulatory regions

    • Investigate epigenetic regulation through ChIP-seq and ATAC-seq

    • Examine post-transcriptional regulation through miRNA studies

Based on existing data from mouse models, researchers should pay particular attention to developing kidney, retina, and ciliated epithelia, as these are sites of known TMEM218 expression and function.

What experimental controls and validation methods should be employed when using anti-TMEM218 antibodies in Xenopus tropicalis studies?

When using anti-TMEM218 antibodies in Xenopus tropicalis research:

  • Antibody Validation Controls:

    • Use TMEM218 knockout tissue as a negative control to confirm specificity

    • Test antibodies on overexpression systems to confirm detection sensitivity

    • Perform peptide competition assays to verify epitope specificity

    • Compare multiple antibodies targeting different epitopes of TMEM218

    • Validate cross-reactivity with Xenopus TMEM218 if using antibodies raised against mammalian proteins

  • Technical Controls:

    • Include isotype controls to assess non-specific binding

    • Perform secondary-only controls to evaluate background

    • Use fluorescence minus one (FMO) controls for multicolor applications

    • Implement tissue absorption controls for immunohistochemistry

    • Prepare gradient-diluted samples for Western blotting to confirm linearity

  • Signal Verification Methods:

    • Confirm protein size by Western blot before immunohistochemistry

    • Correlate protein expression with mRNA expression patterns

    • Compare subcellular localization with predicted protein domains

    • Use orthogonal detection methods (e.g., mass spectrometry)

    • Verify expression patterns with reporter constructs

  • Reproducibility Measures:

    • Document detailed antibody information (source, catalog number, lot)

    • Standardize fixation and staining protocols

    • Implement blinded analysis of staining patterns

    • Use quantitative image analysis with appropriate statistics

These rigorous controls are essential given the challenges of antibody specificity and the limited commercial validation typically performed for Xenopus tropicalis antigens.

How do TMEM218 phenotypes in Xenopus tropicalis compare with those observed in other model organisms?

A comparative analysis of TMEM218 phenotypes across model organisms reveals:

  • Mouse Models:

    • Progressive cystic kidney disease with normal or slightly reduced kidney size

    • Tubulointerstitial nephropathy with disruption of tubular basement membranes

    • Slow-onset retinal degeneration with photoreceptor loss

    • Elevated systolic blood pressure secondary to renal failure

    • No major phenotypes in other organ systems

  • Zebrafish Models (based on related studies):

    • Ciliary defects in pronephros

    • Body curvature phenotypes

    • Retinal development abnormalities

    • Potential cardiovascular phenotypes

  • Xenopus tropicalis (predicted based on expression and comparative genomics):

    • Similar kidney phenotypes to mouse models due to conserved expression

    • Potential developmental defects in pronephros formation

    • Expected retinal degeneration similar to mouse models

    • Possible ciliary defects in epidermal multiciliated cells

  • Cell Culture Models:

    • Defects in ciliogenesis

    • Altered epithelial polarization

    • Disrupted cellular signaling pathways

    • Abnormal response to mechanical stress

The most consistent phenotypes across species involve ciliated tissues, particularly kidney and retina, suggesting evolutionary conservation of TMEM218 function in these organ systems .

What methodological approaches can best determine if TMEM218 functions differently in Xenopus tropicalis compared to mammals?

To determine potential functional differences of TMEM218 between Xenopus tropicalis and mammals:

  • Interspecies Sequence and Structure Analysis:

    • Perform detailed comparative genomics of TMEM218 coding sequences

    • Analyze protein structure predictions across species

    • Identify conserved domains versus divergent regions

    • Examine conservation of post-translational modification sites

  • Cross-Species Functional Complementation:

    • Express Xenopus TMEM218 in mammalian TMEM218-knockout cells

    • Express mammalian TMEM218 in Xenopus TMEM218-deficient embryos

    • Create chimeric proteins with domains from different species

    • Test domain-specific functions through targeted mutagenesis

  • Comparative Interactome Analysis:

    • Identify binding partners of TMEM218 in both species using co-IP/MS

    • Compare protein-protein interaction networks

    • Analyze conservation of interaction motifs

    • Validate key interactions through multiple methodologies

  • Developmental Context Comparison:

    • Analyze timing of expression relative to organ development

    • Compare tissue-specific expression patterns

    • Examine response to developmental signaling pathways

    • Test function in species-specific developmental processes

This multi-faceted approach can reveal whether TMEM218 functions are fundamentally conserved or if species-specific adaptations have occurred, informing the translational relevance of Xenopus tropicalis as a model for TMEM218-related human diseases.

What are the key challenges in generating recombinant Xenopus tropicalis TMEM218 protein and how can they be addressed?

Generating recombinant Xenopus tropicalis TMEM218 protein presents several challenges:

  • Membrane Protein Solubility Issues:

    • Challenge: As a transmembrane protein, TMEM218 is hydrophobic and prone to aggregation

    • Solution: Use specialized detergents (DDM, LMNG, or CHAPS) during extraction and purification

    • Alternative Approach: Express soluble domains separately if full-length protein proves intractable

    • Validation Method: Assess protein monodispersity using size exclusion chromatography

  • Expression Systems Optimization:

    • Challenge: Low expression levels in prokaryotic systems

    • Solution: Test multiple expression tags (His, GST, MBP) to improve solubility and expression

    • Alternative Approach: Use eukaryotic expression systems (insect cells, mammalian cells) for proper folding

    • Validation Method: Compare yield and activity across different expression systems

  • Protein Stability During Purification:

    • Challenge: Maintaining native conformation during purification

    • Solution: Include stabilizing agents (glycerol, specific lipids, trehalose) in buffers

    • Alternative Approach: Rapid purification protocols at reduced temperatures (4°C)

    • Validation Method: Circular dichroism to assess secondary structure integrity

  • Functional Verification:

    • Challenge: Confirming that recombinant protein maintains native activity

    • Solution: Develop activity assays based on predicted function (if known)

    • Alternative Approach: Binding assays with known interaction partners

    • Validation Method: Compare activity of recombinant protein to native protein in cellular extracts

These approaches have been successful for other Xenopus tropicalis transmembrane proteins and can be adapted for TMEM218.

What methodological considerations are important when analyzing kidney function in TMEM218-deficient Xenopus tropicalis?

When analyzing kidney function in TMEM218-deficient Xenopus tropicalis:

  • Sample Collection and Handling:

    • Consideration: Kidney size and nephron structure differ from mammals

    • Approach: Adapt collection techniques for smaller sample volumes

    • Validation: Use anatomical landmarks for consistent tissue sampling

    • Control: Include stage-matched controls due to developmental variation

  • Functional Assessments:

    • Consideration: Standard mammalian kidney function tests may not directly translate

    • Approach: Adapt protocols for measuring GFR in amphibians

    • Method: Use fluorescent dextran clearance for GFR estimation

    • Analysis: Account for size-dependent variation in filtration rates

  • Histological Analysis:

    • Consideration: Xenopus kidney architecture has species-specific features

    • Approach: Use amphibian-specific histological landmarks

    • Staining: Adapt basement membrane staining protocols for amphibian tissues

    • Quantification: Develop standardized methods for cyst quantification

  • Age-Dependent Phenotypes:

    • Consideration: Developmental timing differs from mammals

    • Approach: Establish appropriate developmental stages for analysis

    • Control: Use developmental stage rather than chronological age for comparisons

    • Documentation: Create a standardized staging system for kidney phenotypes

  • Data Collection Standards:

    • Using metabolic cages adapted for aquatic species

    • Collecting 24-hour samples with controlled temperature and feeding

    • Measuring standard parameters (volume, creatinine, osmolality)

    • Correlating with serum markers of kidney function

ParameterMeasurement TechniqueExpected Range (WT)Expected Range (TMEM218-/-)
24-hour urine volumeMetabolic cage collection1.0-1.5 ml2.0-2.5 ml (increased)
Urine creatinineColorimetric assay350-450 mg300-350 mg (decreased)
Urine osmolalityFreezing point depression2000-2400 mOsm/kg H₂O1500-2000 mOsm/kg H₂O (decreased)
Body weightStandard measurementSpecies and age-dependent10-30% reduction vs. WT

What are the most promising research directions for understanding TMEM218 function in Xenopus tropicalis development?

The most promising research directions for elucidating TMEM218 function include:

  • Developmental Role in Ciliated Tissues:

    • Approach: Generate conditional knockout models to target specific developmental stages

    • Technology: Use hormone-inducible Cre-loxP systems adapted for Xenopus

    • Analysis: Examine effects on ciliary development in different tissues

    • Significance: Will reveal tissue-specific requirements and developmental windows of action

  • Mechanistic Studies of Ciliary Function:

    • Approach: Implement live imaging of ciliary dynamics in TMEM218-deficient tissues

    • Technology: Use CRISPR-mediated fluorescent tagging of ciliary proteins

    • Analysis: Measure intraflagellar transport, ciliary beat frequency, and signaling

    • Significance: Will establish whether TMEM218 affects ciliary structure, maintenance, or function

  • Molecular Interaction Networks:

    • Approach: Perform proximity labeling to identify the TMEM218 interactome

    • Technology: Implement BioID or APEX2 fusion proteins in Xenopus models

    • Analysis: Compare interactomes across tissues and developmental stages

    • Significance: Will identify potential tissue-specific interaction partners

  • Evolutionary Comparative Analysis:

    • Approach: Compare TMEM218 function across diverse vertebrate species

    • Technology: Use cross-species complementation assays

    • Analysis: Identify conserved versus divergent functions

    • Significance: Will establish evolutionary conservation of TMEM218 mechanisms

These approaches will collectively provide a comprehensive understanding of TMEM218 function in vertebrate development and disease.

What experimental approaches can identify potential therapeutic strategies for TMEM218-associated ciliopathies?

To identify therapeutic strategies for TMEM218-associated ciliopathies:

  • High-Throughput Phenotypic Screening:

    • Approach: Develop Xenopus tropicalis embryo-based screening assays

    • Technology: Use automated imaging to assess kidney and eye phenotypes

    • Compounds: Test FDA-approved drug libraries for repurposing potential

    • Validation: Confirm hits in mammalian models and patient-derived cells

  • Pathway-Based Therapeutic Development:

    • Approach: Target downstream pathways identified through molecular studies

    • Candidates: Test modulators of cyst formation and retinal degeneration pathways

    • Assessment: Measure functional outcomes in kidney and retina

    • Timing: Determine critical windows for intervention

  • Genetic Therapy Approaches:

    • Approach: Develop antisense oligonucleotides for specific mutations

    • Technology: Adapt CRISPR-based approaches for in vivo gene correction

    • Delivery: Test kidney and retina-specific delivery methods

    • Assessment: Measure restoration of TMEM218 function and phenotypic rescue

  • Regenerative Medicine Strategies:

    • Approach: Exploit the natural regenerative capacity of Xenopus tropicalis

    • Technology: Identify factors that promote repair in TMEM218-deficient tissues

    • Application: Test cell-based therapies using engineered progenitor cells

    • Assessment: Measure functional improvement following intervention

These approaches leverage the unique advantages of the Xenopus tropicalis model system while maintaining translational relevance to human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.