Recombinant Xenopus tropicalis Transmembrane protein 231 (tmem231)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem231; Transmembrane protein 231
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem231
Target Protein Sequence
MALYEVYSHPALLRYRSSICSKATLFILIVLLLTYIPPLLVAFRSYGFWLKTSTYEEQPN VRFQYDVLLIALSSTTGNYLAWSTYPGFNNLVGDKLRLPHISAREEDRNQDGKMDLLNFQ LELPLQPTDNIYGVQLILTFSYQLSKMSTFIMQSMALIQYSSPIPGSQLYMNGDLKLQQR QPLNHRGLDTTYNVSVINRSSPFASTYALTNIISSYQERNVTTVLNAPNPLWIVGRAASD PFVIKAVIRYPVESISYVPGFWEMLKYAWIQYVSILLIFLWVFERIKIFVFQNQVLTTVS GPIPSLYKSHQS
Uniprot No.

Target Background

Function

Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia. This complex acts as a barrier, preventing transmembrane protein diffusion between cilia and the plasma membrane. Tmem231 is essential for ciliogenesis and sonic hedgehog (SHH) signaling.

Database Links
Protein Families
TMEM231 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis tmem231 and what is its primary function?

Transmembrane protein 231 (tmem231) functions as a critical component of the tectonic-like complex, localized at the transition zone of primary cilia. This complex acts as a diffusion barrier that prevents inappropriate movement of transmembrane proteins between the ciliary and plasma membranes . As part of the B9 complex, tmem231 participates in cilia formation and maintenance, which is essential for proper cellular signaling and development .

The protein is evolutionarily conserved, with studies showing conservation of specific amino acid residues across species . In Xenopus tropicalis, tmem231 plays fundamental roles in development, with mutations potentially affecting ciliary function and resulting in developmental abnormalities similar to human ciliopathies.

Why is Xenopus tropicalis preferred over Xenopus laevis for tmem231 research?

Xenopus tropicalis offers several significant advantages over Xenopus laevis for genetic and genomic research on genes like tmem231:

FeatureXenopus tropicalisXenopus laevisResearch Advantage
GenomeDiploidAllotetraploidSimplified genetic analysis and genome organization
Generation timeShorter (4-6 months)Longer (1-2 years)Facilitates multigenerational experiments
Genetic manipulationMore straightforwardMore complex due to redundant genesEasier creation of mutant and transgenic lines
ConservationMore likely to reflect mammalian gene structureShows remodeling of post-tetraploid transcriptomeBetter comparative analysis with human genes

The diploid nature of X. tropicalis makes it particularly valuable for genetic analysis of tmem231 function, as it eliminates complications from gene duplication and redundancy that might obscure loss-of-function phenotypes .

How is tmem231 associated with human ciliopathies?

Mutations in the TMEM231 gene are associated with two primary ciliopathies in humans:

  • Joubert Syndrome (JBTS): Characterized by the "molar tooth sign" on brain imaging, retinopathy, nephropathy, and polydactyly. While some individuals with JBTS die in infancy, most survive with variable developmental outcomes .

  • Meckel-Gruber Syndrome (MKS): A more severe perinatal syndrome characterized by polycystic kidneys, occipital encephalocele, and polydactyly. MKS is typically lethal during the perinatal period .

Approximately 20 variants of TMEM231, including two gene conversions, have been identified in JBTS and MKS patients . The study of tmem231 in Xenopus tropicalis provides valuable insights into how mutations in this gene affect development and can lead to human disease phenotypes.

What are the recommended approaches for cloning and expressing recombinant Xenopus tropicalis tmem231?

Based on established protocols for Xenopus proteins, the following methodological approach is recommended:

  • Gene identification and primer design: Use the Xenbase resource (xenbase.org) to obtain the complete coding sequence for X. tropicalis tmem231 . Design primers that include appropriate restriction sites for your expression vector.

  • RNA isolation and cDNA synthesis: Extract total RNA from appropriate developmental stages of X. tropicalis embryos, followed by reverse transcription to create cDNA.

  • PCR amplification and cloning: Amplify the tmem231 coding sequence and clone into an appropriate expression vector.

  • Expression systems options:

    • Bacterial expression (E. coli): Suitable for protein structure studies but may not preserve post-translational modifications

    • Xenopus oocyte expression: Maintains post-translational modifications and membrane insertion

    • Mammalian cell culture: Provides proper folding and modifications for functional studies

  • Purification strategy: For transmembrane proteins like tmem231, consider using detergent solubilization (e.g., Triton X-100, DDM) followed by affinity chromatography using epitope tags.

When expressing tmem231, consider that as a transmembrane protein, it may require specialized conditions to maintain proper folding and function.

What are effective methods for studying tmem231 localization in Xenopus tropicalis?

Several complementary approaches can be employed:

  • Immunofluorescence microscopy:

    • Fix embryos or tissues at appropriate developmental stages

    • Use antibodies specific to X. tropicalis tmem231 or epitope-tagged versions

    • Co-stain with markers for cilia (acetylated tubulin) and the transition zone

    • Analyze using confocal microscopy to precisely localize tmem231 relative to other ciliary components

  • Live imaging with fluorescent fusion proteins:

    • Generate GFP/RFP-tmem231 fusion constructs

    • Introduce via microinjection of mRNA into early embryos

    • Perform time-lapse imaging to track protein dynamics

  • Electron microscopy:

    • Immunogold labeling for precise subcellular localization

    • Particularly useful for examining tmem231's position within the ciliary transition zone

  • Biochemical fractionation:

    • Isolate ciliary versus non-ciliary membrane fractions

    • Western blotting to detect tmem231 in different fractions

    • Co-immunoprecipitation to identify interacting partners

Research indicates that tmem231 should localize specifically to the ciliary transition zone, where it functions as part of the diffusion barrier between ciliary and plasma membranes .

How can whole-exome sequencing be applied to identify tmem231 mutations in Xenopus tropicalis?

Whole-exome sequencing (WES) has proven effective for identifying mutations in tmem231, as demonstrated in clinical research . For X. tropicalis:

  • Sample preparation:

    • Extract high-quality genomic DNA from X. tropicalis (wild-type and suspected mutants)

    • Prepare exome capture libraries with appropriate kits

  • Sequencing and bioinformatics workflow:

    • Perform paired-end sequencing (minimum 30-50x coverage)

    • Align reads to the X. tropicalis reference genome

    • Identify variants using appropriate algorithms

    • Filter variants based on:

      • Quality scores and read depth

      • Conservation scores

      • Predicted functional impact using tools like SIFT, PolyPhen-2

      • Absence in control populations

  • Validation of identified variants:

    • Confirm variants by Sanger sequencing

    • Perform functional prediction analysis

    • Conduct protein modeling to assess structural impacts

  • Functional validation in X. tropicalis:

    • Generate equivalent mutations using CRISPR/Cas9

    • Analyze phenotypes in F0 or subsequent generations

    • Perform rescue experiments with wild-type tmem231

This approach can identify novel variants like the c.19C>T (p.R7W) mutation described in human TMEM231, which was predicted to alter protein structure and increase local hydrophobicity .

How does tmem231 contribute to ciliary barrier function at the molecular level?

At the molecular level, tmem231 plays a sophisticated role in maintaining ciliary compartmentalization:

  • Structural organization: Tmem231 is an integral component of the B9 complex at the ciliary transition zone. It forms part of the Y-shaped linkers that connect the axonemal microtubules to the ciliary membrane .

  • Barrier mechanism: The protein contributes to the diffusion barrier by:

    • Forming molecular interactions with other transition zone proteins

    • Restricting the lateral movement of membrane proteins between ciliary and plasma membrane compartments

    • Potentially interacting with membrane lipids to create a specialized membrane domain

  • Protein interactions: Tmem231 physically interacts with multiple Joubert syndrome and Meckel-Gruber syndrome-related proteins to form a functional complex that regulates ciliary protein composition .

  • Signaling regulation: By maintaining proper ciliary compartmentalization, tmem231 indirectly regulates critical developmental signaling pathways, particularly Hedgehog signaling. Studies in mouse models show that Tmem231 mutations abrogate Hedgehog signaling and lead to developmental defects including polydactyly .

Understanding these molecular mechanisms is crucial for interpreting how specific mutations in tmem231 lead to ciliopathies and developmental abnormalities.

What structural changes occur in tmem231 due to pathogenic mutations?

Research on pathogenic mutations reveals significant structural alterations in tmem231:

  • Case study of p.R7W mutation: Protein modeling showed that this missense variant (c.19C>T; p.R7W) causes conformational changes in the TMEM231 protein structure. Additionally, ProtScale software analysis demonstrated that this mutation increases local hydrophobicity compared to the wild-type protein .

  • Functional consequences of structural changes:

    • Altered hydrophobicity likely affects protein-protein interactions

    • Structural changes may impair proper localization to the transition zone

    • Modified protein conformation could disrupt the formation of functional complexes with other ciliary proteins

  • Predictive modeling approach:

    • Advanced protein structure prediction tools (e.g., SWISS-MODEL) can be used to model wild-type and mutant tmem231

    • Molecular dynamics simulations can predict how mutations affect protein stability and interactions

    • Hydrophobicity plots can identify regions where mutations might particularly affect membrane association

These structural insights provide crucial information for understanding mechanism-specific pathologies in ciliopathies and could inform therapeutic approaches targeting protein stabilization or interaction restoration.

What are the developmental consequences of tmem231 dysfunction in Xenopus tropicalis?

Based on studies in humans and mouse models, tmem231 dysfunction in X. tropicalis would likely produce several developmental abnormalities:

  • Expected phenotypes:

    • Defects in neural tube patterning and closure

    • Polydactyly (extra digits)

    • Cerebellar vermis hypoplasia

    • Potential kidney and eye developmental abnormalities

  • Developmental mechanisms affected:

    • Disrupted Hedgehog signaling: Tmem231-deficient mouse embryos exhibit abrogated Hedgehog signaling, leading to polydactyly and neural tube dorsalization

    • Altered planar cell polarity: Likely affecting convergent extension movements

    • Potential disruption of other ciliary signaling pathways (Wnt, PDGF, etc.)

  • Temporal aspects:

    • Early developmental defects from gastrulation onward

    • Progressive worsening of phenotypes during organogenesis

Mouse studies demonstrate that homozygous Tmem231-/- embryos die before birth with characteristic ciliopathy features including polydactyly and microphthalmia . Similar developmental consequences would be expected in X. tropicalis, making it a valuable model for studying the developmental basis of human ciliopathies.

How can CRISPR/Cas9 genome editing be optimized for generating tmem231 mutants in Xenopus tropicalis?

Creating precise tmem231 mutants requires specific optimization for the X. tropicalis system:

  • Guide RNA design considerations:

    • Target highly conserved functional domains of tmem231

    • Avoid regions with off-target matches in the X. tropicalis genome

    • Design multiple gRNAs targeting different exons to increase success rates

    • Consider using paired nickase approaches for increased specificity

  • Delivery protocol optimization:

    • Inject Cas9 protein (rather than mRNA) with gRNAs at the one-cell stage

    • Typical effective concentrations: 1-2 ng Cas9 protein and 200-400 pg gRNA

    • Consider adding homology-directed repair templates for precise mutations

  • Screening and validation strategy:

    • T7 endonuclease or heteroduplex mobility assays for initial screening

    • PCR and sequencing to confirm mutations

    • Targeted next-generation sequencing for complex edits

    • Western blotting and immunostaining to confirm protein loss/alteration

  • Establishing stable lines:

    • Raise F0 founders to sexual maturity (4-6 months)

    • Outcross to wild-type animals to reduce off-target mutations

    • Implement gynogenetic diploid screening to rapidly detect recessive phenotypes

The diploid genome of X. tropicalis facilitates more straightforward genetic analysis of CRISPR-generated mutations compared to the allotetraploid X. laevis , making it an ideal system for generating and characterizing tmem231 mutants.

What approaches can resolve contradictory data when studying tmem231 phenotypes?

When encountering conflicting data in tmem231 research, consider these methodological solutions:

  • Genetic background effects:

    • Use multiple X. tropicalis lines to determine if phenotypic differences result from genetic background

    • Consider that different wild-caught X. tropicalis populations, such as those from Nigeria or the Asashima laboratory line from Japan, show genetic divergence

    • Create isogenic lines through inbreeding to minimize background effects

  • Functional redundancy assessment:

    • Identify potential paralogs or functionally related genes in X. tropicalis

    • Create double/triple mutants to address compensation

    • Use transcriptomics to identify upregulated genes in tmem231 mutants

  • Tissue-specific and temporal analyses:

    • Create tissue-specific knockdowns using targeted morpholinos

    • Develop inducible systems to control timing of gene disruption

    • Perform tissue-specific rescue experiments

  • Chimeric analysis:

    • Leverage Xenopus's amenability to tissue transplantation

    • Create chimeras between wild-type and mutant tissues to determine cell autonomy

    • This approach has been successfully used in Xenopus to determine autonomy of developmental defects

  • Cross-species validation:

    • Compare X. tropicalis findings with mouse and human data

    • Use conservation analysis to determine if specific mutations have equivalent effects across species

These approaches capitalize on the experimental advantages of X. tropicalis while addressing the complexities of interpreting developmental phenotypes.

How can protein-protein interactions of tmem231 be reliably investigated?

Studying tmem231's interactions requires specialized approaches for membrane proteins:

  • Proximity labeling techniques:

    • BioID or TurboID fusion with tmem231 expressed in X. tropicalis embryos

    • APEX2-based proximity labeling for temporal control

    • Mass spectrometry identification of labeled proteins

  • Split reporter systems:

    • BiFC (Bimolecular Fluorescence Complementation)

    • Split-luciferase complementation

    • Particularly useful for validating specific interaction partners in vivo

  • Co-immunoprecipitation optimization:

    • Crosslinking before lysis to capture transient interactions

    • Detergent selection critical for maintaining membrane protein interactions

    • Tandem affinity purification for increased specificity

  • Interaction mapping:

    • Yeast two-hybrid using transmembrane fragments

    • Deletion constructs to map specific interaction domains

    • Bioinformatic prediction of interaction motifs

  • In vivo validation:

    • Co-localization studies in X. tropicalis embryos

    • FRET/FLIM imaging for direct interaction evidence

    • Phenotypic analysis of double mutants

TMEM231 is known to physically interact with many JBTS- or MKS-related genes as part of the B9 complex . Investigating these interactions in X. tropicalis can provide insights into the conservation and functional significance of these protein networks.

How conserved is tmem231 across vertebrate species and what does this reveal about its function?

Evolutionary analysis of tmem231 provides important functional insights:

  • Sequence conservation patterns:

    • The arginine at position 7 (R7) in human TMEM231 is highly conserved in primates, suggesting functional importance

    • Comparative analysis of X. tropicalis tmem231 with human TMEM231 reveals conserved functional domains

    • Transmembrane domains typically show higher conservation than loop regions

  • Evolutionary conservation table:

  • Functional implications of conservation:

    • Highly conserved residues often indicate structural or functional importance

    • Conserved domains likely mediate critical protein-protein interactions

    • Species-specific variations may reflect adaptation to different developmental programs

  • Evolutionary constraints:

    • Strong negative selection on mutations affecting barrier function

    • Comparative genomics reveals tmem231 is under purifying selection

The high conservation of critical residues supports the essential role of tmem231 in ciliary function across vertebrates, explaining why mutations in these regions lead to similar developmental defects across species .

How can heterologous expression systems be used to study X. tropicalis tmem231 function?

Heterologous expression provides powerful comparative approaches:

  • Mammalian cell culture systems:

    • Express X. tropicalis tmem231 in IMCD3 or RPE1 cells (common ciliated cell lines)

    • Create human/X. tropicalis chimeric proteins to map functional domains

    • Rescue experiments in TMEM231-knockout human cells with X. tropicalis tmem231

  • Cross-species rescue experiments:

    • Express X. tropicalis tmem231 in mouse Tmem231-/- models

    • Test ability of human TMEM231 to rescue X. tropicalis tmem231 mutants

    • Quantify rescue efficiency to measure functional conservation

  • Domain swapping approach:

    • Create chimeric proteins with domains from different species

    • Identify species-specific functional differences

    • Map critical residues through point mutation analysis

  • Complementary expression systems:

    • Saccharomyces cerevisiae: For protein-protein interaction studies

    • Drosophila S2 cells: For conserved ciliary trafficking mechanisms

    • C. elegans: For in vivo analysis of conserved ciliary functions

  • Readout methods:

    • Ciliary localization efficiency

    • Barrier function assessment using ciliary protein diffusion assays

    • Hedgehog signaling pathway activation

This comparative approach can reveal both conserved mechanisms and species-specific adaptations in tmem231 function, providing insights into the evolution of ciliary transition zone biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.