Recombinant Xenopus tropicalis Transmembrane protein 47 (tmem47)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in sterile deionized water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem47; tm4sf10; Transmembrane protein 47; Transmembrane 4 superfamily member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem47
Target Protein Sequence
MASSASGMEEVRSSVLTPLKLVGLVCIFLALCLDIGAVLSPAWVTADNQYYLSLWESCKK AENLWICDSTLESDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAA VVLQVCGLVLYPIKFIETVTLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY
Uniprot No.

Target Background

Function
Recombinant Xenopus tropicalis Transmembrane protein 47 (tmem47) is a protein that regulates cell junction organization in epithelial cells. It may play a role in the transition from adherens junctions to tight junction assembly.
Database Links
Protein Families
TMEM47 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, adherens junction.

Q&A

What is TMEM47 and why study it in Xenopus tropicalis?

TMEM47 is a transmembrane protein involved in regulating tight junction morphology and assembly in vertebrates. Xenopus tropicalis serves as an excellent model organism for studying TMEM47 due to its diploid genome with high synteny to humans, coupled with experimental advantages including external embryo development, transparency of tadpoles, and a relatively short life cycle . Unlike Xenopus laevis, X. tropicalis provides a simpler genetic background for studying gene function while maintaining the experimental benefits of amphibian models.

How conserved is TMEM47 across species?

TMEM47 is highly evolutionarily conserved across vertebrates. For instance, zebrafish TMEM47 shares approximately 82% identity with human TMEM47 . This conservation suggests functional importance and allows researchers to make meaningful comparisons between findings in X. tropicalis and human systems. Sequence alignment studies between X. tropicalis TMEM47 and human TMEM47 reveal conserved domains that likely contribute to its core cellular functions across species.

What are the primary cellular functions of TMEM47?

TMEM47 has several identified functions across species systems:

  • Regulation of tight junction morphology and assembly

  • Modulation of interferon responses during viral infections (demonstrated in zebrafish)

  • Involvement in cellular resistance to therapeutic agents (shown in cancer cells)

  • Potential role in development and cell differentiation

In zebrafish models, TMEM47 has been shown to interact with MAVS and STING proteins, key factors in interferon induction during viral infection . Similarly, in cancer cell models, TMEM47 overexpression correlates with treatment resistance .

How does TMEM47 expression in X. tropicalis compare to expression in other model organisms during development?

While specific X. tropicalis TMEM47 developmental expression data was not directly available in our search results, comparative analysis can be inferred from related studies. In mouse models, TMEM47 is expressed during kidney development and podocyte differentiation, participating in the regulation of Fyn activity and epithelial cell junction maturation . Researchers should consider conducting temporal and spatial expression analyses in X. tropicalis embryos using techniques such as in situ hybridization and qRT-PCR to establish expression patterns throughout developmental stages. This would facilitate comparison with zebrafish and mammalian TMEM47 expression data.

What methodologies are most effective for studying TMEM47 function in X. tropicalis?

For studying TMEM47 function in X. tropicalis, several complementary approaches are recommended:

  • CRISPR/Cas9-mediated genome editing for generating knockout or knockin models

  • Morpholino antisense oligonucleotide injection for transient knockdown

  • mRNA microinjection for overexpression studies

  • Transgenic approaches using the I-SceI meganuclease method

These techniques are well-established in X. tropicalis and can be effectively applied to study TMEM47 . The mosaic genome editing approach through CRISPR/Cas9 is particularly valuable as it allows for rapid generation of models without waiting for germline transmission.

How might TMEM47 function in immune response modulation in X. tropicalis?

Based on findings in zebrafish, where TMEM47 serves as a negative regulator of interferon production during viral infections , researchers should investigate whether similar mechanisms exist in X. tropicalis. In zebrafish, TMEM47 was found to interact with MAVS and STING, promoting their degradation through an autophagy-lysosome-dependent pathway. Research approaches could include:

  • Co-immunoprecipitation experiments to identify X. tropicalis TMEM47 interaction partners

  • Viral challenge studies comparing wildtype and TMEM47-deficient animals

  • Analysis of interferon pathway activation in TMEM47-overexpressing versus knockdown models

The immune system of Xenopus demonstrates striking similarities to mammals, making it valuable for comparative immunological studies .

What are the optimal conditions for producing recombinant X. tropicalis TMEM47 protein?

For producing recombinant X. tropicalis TMEM47, consider the following methodological approach:

  • Expression system selection: E. coli systems may be suitable for producing the soluble domains, while eukaryotic systems (insect cells or mammalian cells) are preferable for full-length protein with proper folding and post-translational modifications.

  • Purification strategy: A two-step purification process is recommended, typically using affinity chromatography (His-tag or GST-tag) followed by size exclusion chromatography.

  • Buffer optimization: Given TMEM47's transmembrane nature, detergent screening is crucial. Common detergents to test include:

Detergent TypeExamplesConcentration RangeBest For
Non-ionicDDM, OG, Triton X-1000.1-1%Initial extraction
ZwitterionicCHAPS, CHAPSO0.5-1%Maintaining activity
Steroid-basedDigitonin0.1-0.5%Preserving interactions
  • Expression verification: Western blotting using antibodies against either TMEM47 or the fusion tag is essential for confirming successful expression.

What challenges might arise when generating TMEM47 knockout in X. tropicalis using CRISPR/Cas9?

When generating TMEM47 knockout models in X. tropicalis using CRISPR/Cas9, researchers should anticipate several challenges:

  • Guide RNA design: Target selection should avoid regions with high sequence similarity to other genes, particularly other tight junction proteins.

  • Mosaicism: F0 animals will typically be mosaic for mutations. To address this:

    • Use T7 endonuclease assays or deep sequencing to quantify editing efficiency

    • Analyze multiple F0 animals to account for variability

    • Consider establishing stable lines through F1 generation

  • Potential compensation: Other claudin family members might compensate for TMEM47 loss. RNA-seq analysis comparing wildtype and knockout animals can help identify compensatory mechanisms.

  • Phenotypic analysis: Since TMEM47 affects tight junctions, careful examination of epithelial integrity using techniques such as transmission electron microscopy and immunofluorescence is recommended .

How can researchers distinguish between direct and indirect effects of TMEM47 manipulation in X. tropicalis?

To distinguish between direct and indirect effects of TMEM47 manipulation:

  • Time-course experiments: Map the sequence of molecular events following TMEM47 perturbation, with earlier effects more likely to be direct.

  • Rescue experiments: Reintroduce wildtype or mutant versions of TMEM47 to determine which phenotypes can be directly rescued.

  • Domain mutation analysis: Create constructs with mutations in specific functional domains to identify which molecular interactions are responsible for particular phenotypes.

  • Proximity labeling: Use techniques like BioID or APEX2 to identify the immediate interaction partners of TMEM47 in vivo.

  • Controlled expression systems: Use inducible expression systems to limit secondary effects from long-term expression changes.

What conflicting data exists regarding TMEM47 function across different model organisms?

Current research shows some potentially contrasting roles for TMEM47:

  • In cancer contexts, TMEM47 appears to promote resistance to therapeutic agents and is associated with more aggressive phenotypes . Specifically, in breast cancer cells, TMEM47 overexpression induces tamoxifen resistance (IC50 increasing from 1.58 ± 0.19 to 3.12 ± 0.32 μM with a resistance index of 2.30) .

  • In innate immunity, TMEM47 seems to act as a negative regulator of interferon responses in zebrafish, potentially serving as a homeostatic brake on inflammation .

  • In development, TMEM47 plays a role in junction maturation and cellular differentiation.

These seemingly diverse functions might be reconciled by considering TMEM47 as a contextual regulator of cellular signaling pathways or by recognizing tissue-specific roles. Researchers should carefully design experiments in X. tropicalis to address which functions are conserved and which might be species or context-specific.

How can X. tropicalis TMEM47 studies inform cancer research?

X. tropicalis can provide valuable insights for cancer research related to TMEM47 based on several key advantages:

  • Genome editing efficiency: The CRISPR/Cas9 system works efficiently in X. tropicalis, allowing for rapid generation of cancer models through targeted disruption of tumor suppressor genes or activation of oncogenes .

  • Leukemia modeling: While existing X. tropicalis cancer models have focused on solid tumors, the methodology for developing hematologic malignancy models is being established . This could be relevant for studying TMEM47 in blood cancers.

  • Chemoresistance studies: Given TMEM47's role in chemoresistance in human cancer cell lines , X. tropicalis models could be used to study resistance mechanisms in vivo. For example, in hepatocellular carcinoma cells, TMEM47 expression levels positively correlate with cisplatin resistance .

  • Therapeutic target validation: X. tropicalis models could validate whether inhibiting TMEM47 sensitizes tumors to treatment, as suggested by in vitro studies showing knockdown of TMEM47 enhanced sensitivity to cisplatin and tamoxifen in resistant cancer cells .

What is known about TMEM47's role in modulating drug resistance, and how might this be studied in X. tropicalis?

TMEM47 has been implicated in drug resistance across multiple cancer types:

  • In hepatocellular carcinoma:

    • Higher TMEM47 expression is observed in patients not responding to cisplatin-based treatment compared to responders

    • TMEM47 expression correlates with multi-drug resistance-associated protein 1

    • Targeted inhibition of TMEM47 reduces cisplatin resistance via enhanced caspase-mediated apoptosis

  • In breast cancer:

    • TMEM47 is upregulated in tamoxifen-resistant MCF-7 cells (Log2FC = 7.12)

    • Overexpression of TMEM47 increases tamoxifen resistance (IC50 increasing from 1.58 ± 0.19 to 3.12 ± 0.32 μM)

    • Knockdown of TMEM47 resensitizes resistant cells to tamoxifen

To study these mechanisms in X. tropicalis, researchers could:

  • Generate transgenic animals with tissue-specific TMEM47 overexpression

  • Create cancer models using established protocols and modulate TMEM47 expression

  • Evaluate treatment response with various chemotherapeutic agents

  • Analyze molecular pathways affected by TMEM47 manipulation through RNA-seq and proteomics

What genetic interaction studies would be most informative for understanding TMEM47 function in X. tropicalis?

Future genetic interaction studies should focus on:

  • Junction proteins: Investigating interactions between TMEM47 and other tight junction components could reveal its precise role in junction assembly and maintenance.

  • Immune pathway components: Based on zebrafish studies showing TMEM47 interaction with MAVS and STING , similar studies in X. tropicalis could identify conserved immune regulatory functions.

  • Drug resistance mediators: Exploring genetic interactions with known drug resistance factors such as multi-drug resistance proteins and apoptotic regulators would further elucidate TMEM47's role in treatment resistance .

  • Developmental regulators: Given TMEM47's role in development, genetic interaction studies with key developmental pathway components could uncover additional functions.

  • Multiplexed CRISPR screens: Leveraging X. tropicalis' amenability to CRISPR technology, researchers could conduct targeted genetic interaction screens by simultaneously modulating TMEM47 and candidate interactor genes .

How might advances in imaging technologies enhance studies of TMEM47 function in X. tropicalis?

Advanced imaging approaches for studying TMEM47 include:

  • Live imaging of fluorescently tagged TMEM47 in X. tropicalis embryos to track protein localization and dynamics during development and in response to stimuli

  • Super-resolution microscopy (STED, PALM, STORM) to visualize TMEM47's precise subcellular localization and potential colocalization with interaction partners

  • FRET/FLIM analysis to investigate protein-protein interactions in vivo

  • Light sheet microscopy for whole-organism imaging with minimal phototoxicity, particularly valuable for long-term developmental studies

  • Correlative light and electron microscopy (CLEM) to connect fluorescence observations with ultrastructural analysis of tight junctions

The transparent nature of X. tropicalis tadpoles makes them particularly well-suited for advanced in vivo imaging approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.