Recombinant Xenopus tropicalis Transmembrane protein 85 (tmem85)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
emc4; tmem85; ER membrane protein complex subunit 4; Transmembrane protein 85
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
emc4
Target Protein Sequence
MATPSNLVANRGRRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYSDKQVPDTSVQESDHI LVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLL ESSGQRFLQGLVYLIGNLLGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGLLL
Uniprot No.

Target Background

Function
Transmembrane protein 85 (TMEM85) is a component of the endoplasmic reticulum membrane protein complex (EMC). It facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. TMEM85 exhibits a preference for proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features such as charged and aromatic residues. It is involved in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. Additionally, it is essential for the post-translational insertion of tail-anchored (TA) proteins into the ER membrane. By mediating the proper co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with the translocated N-terminus in the ER lumen), TMEM85 controls the topology of multi-pass membrane proteins, including G protein-coupled receptors. Through its regulation of protein membrane insertion, TMEM85 indirectly influences numerous cellular processes.
Database Links
Protein Families
EMC4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Xenopus tropicalis Transmembrane protein 85 (tmem85) and why is it used in research?

Xenopus tropicalis Transmembrane protein 85 (tmem85) is a membrane protein found in the Western clawed frog (Silurana tropicalis). According to protein sequence data, it consists of 180 amino acids with multiple membrane-spanning domains and is encoded by the tmem85 gene . The protein has a molecular structure characterized by transmembrane regions which facilitate its integration into cellular membranes.

This protein serves as an important research tool for several reasons. First, Xenopus tropicalis is a diploid organism with a well-sequenced genome containing more than 20,000 genes, making it valuable for genetic studies . Second, the high conservation between Xenopus and human genomes (sharing approximately 79% of identified human disease genes) makes tmem85 potentially relevant for understanding human membrane protein biology and disease mechanisms .

Methodologically, researchers typically work with recombinant tmem85 through the following workflow:

  • Gene cloning from X. tropicalis cDNA

  • Expression in heterologous systems (bacterial, insect, or mammalian)

  • Purification using affinity chromatography with tags determined during production

  • Functional and structural characterization in relevant experimental systems

  • How should Recombinant Xenopus tropicalis Transmembrane protein 85 (tmem85) be stored and handled in laboratory settings?

Proper storage and handling of Recombinant X. tropicalis tmem85 is critical for maintaining protein activity and structural integrity. Based on standard protocols, the following conditions should be implemented:

Storage recommendations:

  • Store at -20°C for regular use

  • For extended storage, maintain at -80°C

  • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability

  • Repeated freezing and thawing should be avoided as it can compromise protein integrity

Handling procedures:

  • Working aliquots can be stored at 4°C for up to one week

  • When thawing frozen stock, place on ice and use immediately once thawed

  • For experiments requiring native conformation, maintain detergent concentrations above the critical micelle concentration throughout all handling steps

  • Consider the addition of protease inhibitors when working with the protein for extended periods

For experimental applications, researchers should perform optimization studies to determine the most suitable buffer conditions for specific applications (e.g., binding assays, structural studies, or functional reconstitution). The integrity of the protein should be verified before use through methods such as SDS-PAGE or Western blotting to ensure experimental reliability.

  • What are the advantages of studying tmem85 in Xenopus tropicalis compared to other model organisms?

Xenopus tropicalis offers several distinct advantages for studying transmembrane proteins like tmem85 that make it particularly valuable for comprehensive analyses:

Genomic advantages:

  • Diploid genome (unlike the pseudotetraploid X. laevis), which simplifies genetic manipulation and analysis

  • High conservation of gene synteny with the human genome, enabling translational research

  • Fully sequenced genome with more than 20,000 genes, providing complete genomic context

  • Shares approximately 79% of identified human disease genes, making findings relevant to human health

Experimental advantages:

  • Shorter generation time (4-6 months vs. 12 months for X. laevis), accelerating genetic studies

  • Large embryos allow easy microinjection and manipulation of genetic material

  • External development enables direct observation of developmental processes and protein expression

  • Transparent tadpoles facilitate imaging of protein expression and localization

Genetic manipulation capabilities:

  • Efficient CRISPR/Cas9 genome editing with phenotype analysis possible in F0 generations

  • Ability to perform unilateral injections, where one side of the embryo serves as an internal control

  • Ease of creating tissue-specific transgenic lines for targeted expression studies

  • Simplified genotyping compared to tetraploid species

FeatureXenopus tropicalisXenopus laevisZebrafishMice
GenomeDiploidAllotetraploidDiploidDiploid
Generation time4-6 months12+ months3-4 months10-12 weeks
Embryo manipulationEasy, large embryosEasy, large embryosModerateDifficult
Genome conservation with humansHighHighModerateHigh
Housing requirementsAquatic, minimal spaceAquatic, larger tanksAquatic, minimal spaceTerrestrial, significant space
Cost effectivenessHighModerateHighLow

These advantages position X. tropicalis as an ideal system for studying membrane proteins like tmem85, particularly when investigating developmental roles, tissue-specific functions, or disease-relevant mechanisms.

  • What methods are recommended for analyzing tmem85 expression patterns in Xenopus tropicalis tissues?

To effectively analyze tmem85 expression patterns in X. tropicalis tissues, researchers should employ multiple complementary approaches:

Transcriptional analysis:

  • Quantitative RT-PCR to measure mRNA levels across tissues and developmental stages

  • RNA-Seq for comprehensive transcriptome profiling with stage-specific resolution

  • In situ hybridization to visualize spatial expression patterns in embryos and tissue sections

  • Microarray analysis using X. tropicalis gene chips to examine expression changes across experimental conditions

Protein detection:

  • Immunohistochemistry using anti-tmem85 antibodies on tissue sections

  • Western blotting for quantitative protein analysis across tissues

  • Immunofluorescence microscopy for subcellular localization of the protein

  • Mass spectrometry-based proteomics for comprehensive protein identification and quantification

Reporter systems:

  • Creation of transgenic X. tropicalis lines with fluorescent reporters driven by the tmem85 promoter

  • CRISPR knock-in of tags to visualize endogenous protein expression

  • Bimolecular fluorescence complementation to study protein interactions in vivo

Dynamic expression analysis:

  • Time-course studies during embryonic development to correlate expression with developmental events

  • Analysis following experimental manipulations (e.g., drug treatments, microinjection of morpholinos)

  • Comparison between wildtype and mutant backgrounds to identify regulatory mechanisms

When analyzing membrane proteins like tmem85, special consideration should be given to tissue processing methods that preserve membrane integrity and protein localization. The transparency of X. tropicalis tadpoles makes them particularly suitable for live imaging approaches to monitor protein dynamics in real-time . Researchers should also correlate expression patterns with known developmental markers to establish potential functional relationships.

  • How can recombinant Xenopus tropicalis tmem85 be used for antibody production and validation?

Generating and validating antibodies against X. tropicalis tmem85 requires careful planning and rigorous quality control:

Antigen preparation strategies:

  • Recombinant full-length protein expression in E. coli, insect, or mammalian systems

  • Synthetic peptide antigens corresponding to hydrophilic regions of tmem85

  • Fusion proteins that present tmem85 epitopes in a soluble, immunogenic form

  • Purified protein domains that retain native conformation

Immunization approaches:

  • Multi-species immunization (rabbit, mouse, chicken) to increase the probability of generating specific antibodies

  • Prime-boost strategies with different antigen formats to enhance specificity

  • Adjuvant selection based on antigen properties to maximize immune response

  • Titer monitoring to determine optimal harvesting timepoints

Antibody validation protocol:

  • Initial screening using ELISA against the immunizing antigen

  • Western blot analysis against recombinant protein and X. tropicalis tissue lysates

  • Immunoprecipitation to confirm recognition of native protein

  • Immunohistochemistry on X. tropicalis tissues with appropriate controls

  • Verification in tmem85 knockdown/knockout models to confirm specificity

  • Cross-reactivity testing against related proteins and other species

Optimization considerations:

  • For membrane proteins like tmem85, use native membrane preparations for validation

  • Include detergent screening to identify conditions that maintain epitope accessibility

  • Perform epitope mapping to determine the specific binding regions

  • Consider monoclonal antibody development for applications requiring high specificity

Rigorous validation is critical when working with transmembrane proteins due to potential cross-reactivity with other membrane proteins. The diploid nature of X. tropicalis provides an advantage for antibody validation compared to X. laevis, as knockout models generated through CRISPR/Cas9 can more easily eliminate all endogenous protein expression .

Advanced Research Questions

  • How can CRISPR/Cas9 genome editing be optimized for studying tmem85 function in Xenopus tropicalis?

Optimizing CRISPR/Cas9 genome editing for studying tmem85 in X. tropicalis requires careful consideration of multiple parameters to achieve efficient and specific gene modification:

Guide RNA design and validation:

  • Design multiple sgRNAs targeting different exons of tmem85, preferably early coding regions

  • Screen sgRNAs using in silico tools to minimize off-target effects in the X. tropicalis genome

  • Test sgRNA efficiency using in vitro cleavage assays before embryo injection

  • For functional domain analysis, design sgRNAs to create specific mutations rather than complete knockouts

Delivery optimization:

  • Inject CRISPR components at the one-cell stage for whole-organism knockout

  • For tissue-specific studies, use targeted injections at specific blastomeres based on X. tropicalis fate maps

  • Test different concentrations of Cas9 protein (or mRNA) and sgRNA to balance editing efficiency with toxicity

  • Consider using Cas9 variants with improved specificity to minimize off-target effects

Mutation detection and characterization:

  • Implement T7 Endonuclease I assay or Sanger sequencing with TIDE analysis for initial screening

  • Use targeted deep sequencing for comprehensive mutation profiling

  • Develop specific PCR assays for genotyping F1 animals

  • Sequence multiple founder animals to identify the most useful mutations for further study

Phenotypic analysis strategies:

  • Take advantage of X. tropicalis' ability to perform analysis in F0 "crispants"

  • Leverage unilateral injection approach (unique to Xenopus) to use the uninjected side as an internal control

  • Combine with lineage tracers to identify edited cells in mosaic animals

  • Implement tissue-specific phenotype analysis based on tmem85 expression pattern

The diploid genome of X. tropicalis makes it particularly advantageous for CRISPR studies compared to the pseudotetraploid X. laevis, as only two alleles need to be modified rather than four . This genetic simplicity facilitates faster generation of complete knockouts and more straightforward interpretation of resulting phenotypes.

  • What approaches are most effective for studying the membrane topology and structural characteristics of tmem85?

Understanding the membrane topology and structural characteristics of tmem85 requires a multi-faceted approach combining computational, biochemical, and biophysical techniques:

Computational prediction and analysis:

  • Hydropathy plot analysis to identify potential transmembrane domains in the 180-amino acid sequence

  • Topology prediction using algorithms like TMHMM, Phobius, or TOPCONS

  • Homology modeling based on related proteins with known structures

  • Molecular dynamics simulations to predict protein behavior in membrane environments

Biochemical topology mapping:

  • Protease protection assays to determine cytoplasmic vs. luminal domains

  • Glycosylation scanning mutagenesis to identify luminal regions

  • Cysteine accessibility methods to map exposed residues

  • Limited proteolysis combined with mass spectrometry for domain identification

Structural biology approaches:

MethodResolutionAdvantagesChallenges for tmem85
X-ray crystallographyAtomicHighest resolutionDifficult to crystallize membrane proteins
Cryo-electron microscopyNear-atomicWorks with smaller amounts of proteinSample preparation challenges
NMR spectroscopyAtomicDynamic information availableSize limitations (tmem85 may be too large)
SAXS/SANSLowWorks in solutionLimited structural details
HDX-MSMediumConformational dynamicsComplex data interpretation

Functional validation of structural models:

  • Site-directed mutagenesis of predicted functional residues

  • Cross-linking studies to identify proximity relationships

  • FRET-based approaches to study conformational changes

  • Expression of truncated variants to identify functional domains

For X. tropicalis tmem85 specifically, recombinant expression systems should be optimized to produce sufficient quantities of properly folded protein for structural studies . The amino acid sequence information available for the protein (MATPSNLVANRGRRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYSDKQVPDTSVQESDHILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLLESSGQRFLQGLVYLIGNLLGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGLLL) can guide the design of constructs for these structural studies .

  • How can transgenic Xenopus tropicalis models be developed to study tissue-specific functions of tmem85?

Developing transgenic X. tropicalis models for tissue-specific study of tmem85 involves several strategic approaches:

Transgenic construct design:

  • Tissue-specific promoter driving tmem85 expression (wild-type, tagged, or mutant versions)

  • Conditional expression systems (e.g., Gal4/UAS, Tet-On/Off) for temporal control

  • Fluorescent protein fusions to track expression and localization

  • Rescue constructs for complementation studies in mutant backgrounds

Transgenic methods optimized for X. tropicalis:

  • I-SceI meganuclease-mediated transgenesis for high efficiency integration

  • Tol2 transposon-based integration for improved germline transmission

  • PhiC31 integrase-mediated site-specific integration for reproducible expression

  • CRISPR/Cas9-mediated targeted knock-in for precise genomic modification

Experimental design considerations:

  • Generate F0 transgenic embryos for preliminary analysis of phenotypes

  • Establish stable transgenic lines through breeding (facilitated by X. tropicalis' 4-6 month generation time)

  • Implement tissue-specific knockout/knockdown using CRISPR or morpholinos

  • Design rescue experiments to validate phenotype specificity

Advanced transgenic approaches:

  • Binary expression systems for spatiotemporal control (e.g., heat shock induction)

  • Combinatorial approaches using Cre/loxP for lineage tracing and conditional expression

  • Inducible degradation systems for acute protein depletion

  • Optogenetic tools for light-controlled protein activity

The diploid genome of X. tropicalis significantly simplifies the generation and analysis of transgenic lines compared to X. laevis . Additionally, the transparency of X. tropicalis tadpoles facilitates visualization of fluorescent reporters without the need for tissue clearing or sectioning . These advantages, combined with well-established fate maps that enable targeted manipulations , make X. tropicalis an excellent system for studying tissue-specific functions of tmem85 through transgenic approaches.

  • What are the current methodologies for investigating potential roles of tmem85 in Xenopus tropicalis development and disease models?

Investigating tmem85's roles in development and disease modeling requires integrated approaches combining molecular, cellular, and physiological methodologies:

Developmental expression profiling:

  • Stage-specific qRT-PCR and RNA-Seq analysis across the X. tropicalis developmental timeline

  • Whole-mount in situ hybridization to map spatial expression patterns

  • Immunohistochemistry with tissue-specific markers to identify expressing cell types

  • Single-cell RNA-Seq to identify specific cell populations expressing tmem85

Loss-of-function approaches:

  • CRISPR/Cas9 knockout of tmem85 (complete or domain-specific)

  • Morpholino-mediated knockdown (translation-blocking or splice-blocking)

  • Dominant-negative construct overexpression through microinjection

  • Small molecule inhibitors (if available for tmem85)

Gain-of-function studies:

  • mRNA microinjection for overexpression in specific tissues

  • Transgenic overexpression (ubiquitous or tissue-specific)

  • Expression of constitutively active forms to identify downstream effects

  • Targeted gene activation using CRISPR activation systems

Human disease modeling:

  • Introduction of patient-specific variants using CRISPR/Cas9

  • Phenotypic analysis focusing on affected organs/tissues

  • Rescue experiments with wild-type protein to confirm causality

  • Drug screening using disease model phenotypes for therapeutic discovery

Molecular pathway analysis:

ApproachApplicationOutput
RNA-SeqTranscriptome changesDifferential gene expression profiles
ProteomicsProtein interaction networksIdentification of binding partners
PhosphoproteomicsSignaling pathway mappingPhosphorylation cascade identification
ChIP-SeqTranscriptional regulationDNA binding site identification
MetabolomicsMetabolic pathway analysisAltered metabolite profiles

The advantages of X. tropicalis for disease modeling include the conservation of 79% of human disease genes , the ability to perform unilateral injections with the contralateral side serving as internal control , and the capacity to rapidly generate and analyze F0 mutants without waiting for germline transmission . These features make X. tropicalis particularly valuable for studying how alterations in tmem85 might contribute to human disease states.

  • How can protein-protein interaction networks involving tmem85 be characterized in Xenopus tropicalis?

Characterizing protein-protein interaction networks for tmem85 in X. tropicalis requires specialized approaches optimized for membrane proteins:

Affinity-based methods:

  • Co-immunoprecipitation with anti-tmem85 antibodies from X. tropicalis tissues

  • Tandem affinity purification using tagged tmem85 expressed in transgenic animals

  • BioID or APEX2 proximity labeling to identify neighboring proteins in living cells

  • Pull-down assays with recombinant tmem85 domains and X. tropicalis tissue lysates

Genetic and functional interaction screens:

  • Synthetic lethality screens combining tmem85 knockdown with other genes

  • Modifier screens using F0 CRISPR mutants to identify genetic interactors

  • Suppressor/enhancer screens in sensitized backgrounds to map functional relationships

  • Double knockout/knockdown studies to identify redundant or synergistic pathways

Live-cell interaction detection:

  • Förster resonance energy transfer (FRET) between fluorescently tagged tmem85 and candidate partners

  • Bimolecular fluorescence complementation (BiFC) in Xenopus embryos to visualize interactions

  • Fluorescence correlation spectroscopy for dynamics and stoichiometry of complexes

  • Single-molecule tracking to identify co-diffusing complexes in membrane environments

Advanced proteomics approaches:

MethodApplicationAdvantages for tmem85 studies
Cross-linking mass spectrometryInteraction interface mappingPreserves transient interactions
Hydrogen-deuterium exchange MSConformational dynamicsIdentifies binding-induced changes
Native mass spectrometryComplex compositionMaintains non-covalent interactions
Thermal proteome profilingInteraction stabilitySystem-wide interaction mapping
Label-free quantitative proteomicsComparative interactomicsIdentifies condition-specific interactions

For membrane proteins like tmem85, special consideration must be given to maintaining native membrane environments during isolation and analysis. The X. tropicalis system offers unique advantages for studying protein interactions, including the capacity to visualize interactions in developing embryos and to rapidly test functional consequences of disrupting specific interactions through targeted microinjection approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.