Recombinant Xenopus tropicalis Transmembrane protein 93 (tmem93)

What is Xenopus tropicalis Transmembrane protein 93 (tmem93) and its key characteristics?

Xenopus tropicalis Transmembrane protein 93 (tmem93) is a 110-amino acid protein also known as ER membrane protein complex subunit 6 (emc6). It functions as part of the ER membrane protein complex and has the UniProt ID Q6GLC5. The protein contains transmembrane domains characteristic of membrane-integrated proteins. The full amino acid sequence is: MAGVALKREGPQFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTALYGFIFYFLASF LLSLLLVLKSGRKWNKYFKSRKPLFTGGLIGGLFTYVLFWTFLYGMVHVY. This protein has been successfully expressed in E. coli systems with an N-terminal His tag to facilitate purification and experimental manipulation .

Why is Xenopus tropicalis an appropriate model for studying tmem93?

Xenopus tropicalis serves as an excellent model for studying transmembrane proteins like tmem93 due to several key advantages. First, X. tropicalis has a diploid genome that is highly conserved between frogs and humans, with significant synteny making orthologous gene identification straightforward. Second, the comprehensive model organism database Xenbase provides user-friendly access to an accurately annotated reference genome with excellent tools for genetic analysis. Additionally, X. tropicalis is cost-effective compared to rodent models, can be induced to mate year-round (producing 4000+ embryos per day), and develops rapidly with functional organ systems by day 4 post-fertilization. Furthermore, embryos can absorb small molecules from their culture medium, facilitating drug screening applications. These characteristics make X. tropicalis ideal for studying membrane proteins like tmem93 in developmental contexts .

What are the optimal storage and reconstitution conditions for recombinant tmem93?

For optimal storage of recombinant Xenopus tropicalis tmem93 protein, the lyophilized powder should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses to avoid repeated freeze-thaw cycles, which can compromise protein integrity. When reconstituting the protein, briefly centrifuge the vial to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default) and then aliquot for long-term storage at -20°C/-80°C. The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. Repeated freezing and thawing should be avoided to maintain protein integrity, and working aliquots can be stored at 4°C for up to one week .

What experimental applications is recombinant tmem93 suitable for?

Recombinant Xenopus tropicalis tmem93 protein with His tag is primarily validated for SDS-PAGE applications, where its purity can be confirmed to be greater than 90%. Beyond this basic application, researchers can utilize the protein for various experimental approaches including but not limited to: immunoprecipitation studies to identify interaction partners, structural studies to understand membrane integration, functional assays to determine its role in ER membrane complex formation, and as an antigen for antibody production. Additionally, the protein can serve as a positive control in Western blot analyses and for developing protocols for membrane protein purification. When designing experiments, researchers should consider that the His tag may influence protein behavior in some applications and may need to be cleaved for certain structural or functional studies .

What CRISPR-Cas9 strategies are most effective for tmem93 gene disruption in Xenopus tropicalis?

For efficient CRISPR-Cas9 mediated disruption of tmem93 in Xenopus tropicalis, a ribonucleoprotein (RNP) approach is recommended based on established protocols for similar genes. This method involves injecting a pre-formed complex of sgRNA and Cas9 protein directly into one-cell-stage fertilized eggs. For maximum efficiency, design at least two sgRNAs targeting different regions of the gene - one targeting the coding region (to produce frameshift mutations) and another potentially targeting an exon-intron junction (to produce splicing errors). For example, in similar studies with thyroid hormone receptor beta (trβ), researchers designed sgRNAs targeting the coding region of the 2nd exon and across the 2nd exon-2nd intron junction. This CRISPR-based system has several advantages over other genome-editing tools for X. tropicalis, including higher efficiency, convenience, and cost-effectiveness. After injection, normally developed embryos should be collected the following day, and a subset analyzed by genotyping to confirm disruption at the target site. This approach can generate F0 "crispants" with high rates of somatic mutations, allowing for rapid functional analysis without waiting for germline transmission .

How can researchers differentiate between tmem93 (emc6) specific phenotypes and off-target effects in CRISPR-generated mutants?

Differentiating between true tmem93-specific phenotypes and potential off-target effects in CRISPR-generated Xenopus tropicalis mutants requires multiple complementary approaches. First, implement a comprehensive control strategy including the use of multiple independent sgRNAs targeting different regions of the tmem93 gene. Consistent phenotypes across different sgRNA targets strongly suggest specificity to tmem93 disruption rather than off-target effects. Second, perform rescue experiments by introducing wildtype tmem93 mRNA (resistant to CRISPR targeting) into mutant embryos - successful phenotype rescue confirms specificity. Third, conduct detailed off-target analysis through bioinformatic prediction of potential off-target sites followed by targeted sequencing of these regions in mutant animals. Fourth, generate and compare F1 heterozygotes from different F0 founders, as consistent phenotypes in F1 animals with different potential off-target profiles strongly support tmem93-specific effects. Finally, use alternative approaches such as morpholinos or dominant-negative constructs as independent methods to confirm the observed phenotypes. This multi-faceted approach ensures rigorous validation of tmem93-specific functions versus potential technical artifacts .

What methodologies are recommended for studying tmem93's potential role in metamorphosis in Xenopus tropicalis?

To investigate tmem93's potential role in Xenopus tropicalis metamorphosis, implement a comprehensive experimental design combining genetic, molecular, and physiological approaches. First, generate tmem93-disrupted animals using CRISPR-Cas9 as described for similar studies with thyroid hormone receptor genes. Second, assess metamorphic progression using standardized staging criteria across multiple developmental timepoints, examining both gross morphological changes (gill resorption, limb development, tail resorption) and organ-specific remodeling. Third, analyze metamorphic responsiveness to exogenous thyroid hormone (T3) treatment in pre-metamorphic tadpoles, comparing wild-type and tmem93-disrupted animals. Fourth, perform tissue-specific and temporal gene expression profiling using RT-qPCR and RNA-seq to examine changes in metamorphosis-associated genes. Fifth, conduct protein-protein interaction studies to identify tmem93's potential binding partners during metamorphosis, particularly focusing on thyroid hormone signaling components. Finally, perform comparative analysis with known metamorphosis regulators such as thyroid hormone receptors alpha and beta. This integrated approach can reveal whether tmem93 contributes to specific aspects of metamorphosis timing, tissue remodeling, or hormone responsiveness, similar to findings with other transmembrane proteins in amphibian development .

What are the challenges and solutions for studying protein-protein interactions involving tmem93 in Xenopus models?

Studying protein-protein interactions (PPIs) involving tmem93 in Xenopus models presents several technical challenges with corresponding methodological solutions. First, the transmembrane nature of tmem93 makes traditional co-immunoprecipitation difficult due to solubility issues; this can be addressed using specialized detergents (e.g., digitonin, DDM, or CHAPS) that preserve membrane protein interactions while enabling solubilization. Second, the relatively low expression levels of endogenous tmem93 may limit detection sensitivity; researchers can overcome this by using the available recombinant His-tagged tmem93 protein to develop high-affinity antibodies or by creating transgenic lines expressing tagged versions of tmem93. Third, developmental stage-specific interactions may be missed in whole-embryo studies; this requires careful microdissection of specific tissues at defined developmental stages. Fourth, distinguishing direct versus indirect interactions requires proximity-based methods such as BioID or APEX2 proximity labeling adapted for Xenopus systems. Finally, confirming the functional relevance of identified interactions necessitates combining PPI data with loss-of-function studies using the established CRISPR-Cas approaches. Researchers should also consider membrane yeast two-hybrid systems or split-GFP complementation assays specifically optimized for membrane proteins as alternatives to traditional interaction methods .

How can researchers effectively analyze the evolutionary conservation of tmem93 function between Xenopus and mammalian systems?

To effectively analyze evolutionary conservation of tmem93 function between Xenopus and mammalian systems, researchers should implement a multi-dimensional comparative approach. Begin with comprehensive sequence analysis comparing tmem93/emc6 across species using tools like BLAST, MUSCLE alignment, and phylogenetic tree construction to identify conserved domains and species-specific variations. Calculate conservation scores for specific protein regions, particularly transmembrane domains and potential interaction motifs. Next, conduct structural prediction and comparison using tools like AlphaFold2 to determine if predicted protein folding patterns are conserved despite sequence differences. For functional analysis, perform complementation studies by expressing Xenopus tmem93 in mammalian cell lines with CRISPR-disrupted endogenous emc6 to test functional rescue capabilities. Additionally, compare protein interaction networks using interactome mapping techniques in both systems to identify conserved binding partners. Generate comparable loss-of-function models in both Xenopus and mouse systems using harmonized CRISPR-Cas9 targeting strategies to enable direct phenotypic comparison. Finally, conduct tissue-specific and developmental stage-matched transcriptomic profiling to compare downstream gene regulation patterns. This integrated approach can distinguish between truly conserved functions and species-specific adaptations, providing insight into fundamental versus specialized roles of tmem93 across vertebrate evolution .

What purification strategies yield the highest purity and activity for recombinant tmem93?

For optimal purification of recombinant Xenopus tropicalis tmem93 with maximum purity and activity, a multi-step chromatography approach is recommended. Since the commercially available protein contains an N-terminal His tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as an effective initial purification step. The protocol should be optimized with a binding buffer containing 20-50 mM imidazole to reduce non-specific binding, followed by elution with 250-300 mM imidazole. For membrane proteins like tmem93, incorporate mild detergents such as 0.1% DDM or 0.5% CHAPS throughout the purification process to maintain solubility without denaturing the protein. Following IMAC, a second purification step using size exclusion chromatography (SEC) is crucial for removing aggregates and achieving >95% purity. The SEC buffer should contain reduced detergent concentrations and stabilizing agents like glycerol (10%). Activity can be preserved by including reducing agents such as 1 mM DTT or 2 mM β-mercaptoethanol in all buffers. For applications requiring extremely high purity, consider adding an ion exchange chromatography step between IMAC and SEC. Throughout purification, maintain temperature at 4°C and minimize exposure to proteases by including protease inhibitor cocktails. The final purified protein should be immediately aliquoted, flash-frozen, and stored at -80°C to maintain activity .

What experimental design considerations are crucial when using Xenopus tropicalis for modeling human diseases related to tmem93/emc6?

When designing experiments using Xenopus tropicalis to model human diseases potentially related to tmem93/emc6 dysfunction, several critical considerations must be addressed. First, conduct thorough genetic architecture analysis to determine if the human disease involves loss-of-function, gain-of-function, or dominant-negative mechanisms, as this will dictate your gene manipulation strategy in Xenopus. Second, assess conservation at multiple levels: sequence homology, protein domain structure, and genomic context (synteny) between human and Xenopus tmem93/emc6 to ensure the frog ortholog can reasonably model human gene function. Third, develop a comprehensive phenotyping strategy that includes both molecular readouts (transcriptomics, proteomics) and functional assays relevant to the disease manifestations, recognizing that certain human phenotypes may manifest differently in amphibians due to anatomical and physiological differences. Fourth, implement rigorous controls including wild-type siblings, sham-injected controls, and rescue experiments with human tmem93/emc6 to validate phenotype specificity. Fifth, consider potential penetrance and expressivity variations by examining sufficient numbers of F0 crispants and, ideally, F1 animals. Additionally, evaluate sex differences in phenotype manifestation, particularly for post-metamorphic studies. Finally, acknowledge the anatomical differences between Xenopus and humans (e.g., Xenopus has pronephric kidneys, three-chambered heart) while focusing on conserved molecular mechanisms that can provide translational insights despite these differences .

What are the most reliable antibody validation methods for studying tmem93 expression in Xenopus tissues?

Reliable antibody validation for studying tmem93 expression in Xenopus tissues requires a comprehensive multi-step approach. First, perform in silico epitope analysis comparing human and Xenopus tmem93 sequences to select antibodies targeting highly conserved regions or, ideally, generate Xenopus-specific antibodies using the available recombinant protein as an immunogen. Second, implement the gold standard validation using genetic knockout controls - test antibodies on tissues from CRISPR-generated tmem93-null Xenopus embryos, where specific signals should be absent while non-specific binding may persist. Third, conduct Western blot analysis with appropriate positive controls (tissues with known tmem93 expression) and negative controls (tmem93-depleted samples), ensuring the detected band matches the predicted molecular weight (approximately 12 kDa for the native protein or slightly larger for the His-tagged version). Fourth, perform peptide competition assays where pre-incubation of the antibody with excess tmem93-derived peptides should eliminate specific signals. Fifth, validate subcellular localization patterns using immunofluorescence combined with markers for the ER membrane (expected localization based on emc6 function) and compare patterns with published data on emc6 localization in other species. Finally, confirm expression patterns using orthogonal methods such as RNA in situ hybridization to correlate protein detection with mRNA expression. This rigorous validation pipeline ensures reliable detection of tmem93 across developmental stages and experimental conditions .

How can researchers effectively analyze the impact of tmem93 mutations on ER membrane complex formation?

To effectively analyze how tmem93 mutations impact ER membrane complex (EMC) formation in Xenopus tropicalis, implement a multi-faceted experimental strategy combining biochemical, cellular, and functional approaches. First, generate specific tmem93 mutations using CRISPR-Cas9, targeting conserved domains identified through sequence alignment with mammalian EMC6. Second, use blue native polyacrylamide gel electrophoresis (BN-PAGE) to analyze intact membrane protein complexes, comparing complex assembly patterns between wild-type and mutant samples, with subsequent Western blotting to detect specific EMC components. Third, employ quantitative co-immunoprecipitation with antibodies against other EMC components (EMC1-5, EMC7-10) to assess how tmem93 mutations affect interaction stoichiometry and stability. Fourth, analyze subcellular localization using confocal microscopy with co-staining for other EMC components and ER markers to determine if mutations disrupt proper localization. Fifth, implement proximity labeling techniques (BioID or APEX2) fused to wild-type or mutant tmem93 to capture dynamic interaction partners in living cells. Sixth, use quantitative proteomics to compare the composition of purified EMC complexes between wild-type and mutant conditions, identifying components that may fail to incorporate. Finally, assess functional consequences through analysis of ER stress markers (BiP, CHOP, XBP1 splicing) and membrane protein client misfolding, providing a comprehensive view of how specific tmem93 mutations impact EMC assembly and function in a developmental context .

How might tmem93/emc6 research in Xenopus contribute to understanding human ER-associated diseases?

Research on tmem93/emc6 in Xenopus tropicalis has significant potential to advance understanding of human ER-associated diseases through several translational pathways. The ER membrane protein complex, of which tmem93/emc6 is a component, plays crucial roles in membrane protein biogenesis, folding, and trafficking. Dysfunction in these processes underlies numerous human diseases including certain neurodegenerative disorders, diabetes, and cancer. The Xenopus model offers unique advantages for studying tmem93/emc6 in disease contexts: its embryos develop externally and rapidly, enabling high-throughput phenotypic screening of disease-associated variants; its diploid genome facilitates genetic manipulation; and developmental effects of tmem93/emc6 dysfunction can be readily observed. Researchers can generate tmem93-disrupted Xenopus models using established CRISPR-Cas techniques to investigate how loss of this protein affects ER homeostasis, unfolded protein response activation, and cell-type specific vulnerability to ER stress. Additionally, humanized Xenopus models expressing patient-derived tmem93/emc6 variants can reveal pathogenic mechanisms and serve as platforms for therapeutic screening. As the patient-driven gene discovery field expands, these cost-effective, rapid, and higher throughput Xenopus approaches provide essential complementary insights to mammalian models, especially for early developmental phenotypes that may be challenging to study in mice due to embryonic lethality .

What advanced imaging techniques are most suitable for visualizing tmem93 dynamics in living Xenopus embryos?

For visualizing tmem93 dynamics in living Xenopus embryos, several advanced imaging techniques offer complementary advantages. Light sheet fluorescent microscopy (LSFM) is particularly valuable due to its minimal phototoxicity, rapid acquisition speed, and ability to image whole embryos with cellular resolution. This approach can be implemented using mNeonGreen or mEmerald-tagged tmem93 to achieve optimal brightness and photostability in the Xenopus embryonic environment. For subcellular dynamics, spinning disk confocal microscopy provides the necessary spatial resolution while minimizing photobleaching for extended time-lapse imaging of tmem93 movement within the ER membrane. Super-resolution techniques such as structured illumination microscopy (SIM) can resolve tmem93 distribution within ER subdomains with approximately 100nm resolution while remaining compatible with live imaging. For protein-protein interactions, Förster resonance energy transfer (FRET) microscopy using tmem93 fused to appropriate fluorophore pairs can detect dynamic associations with other EMC components. Additionally, photoactivatable or photoconvertible fluorescent protein fusions (e.g., mEos3.2-tmem93) enable pulse-chase experiments to track newly synthesized protein populations. For all these approaches, microinjection of mRNA encoding the fluorescent fusion proteins at the one-cell stage allows for controlled expression levels. These techniques can be further enhanced using lattice light-sheet microscopy for long-term imaging with minimal phototoxicity or by combining with optogenetic approaches to manipulate tmem93 function with spatiotemporal precision during developmental events .

What experimental approaches can determine if tmem93 has tissue-specific functions during Xenopus development?

To determine if tmem93 has tissue-specific functions during Xenopus development, implement a systematic multi-level experimental strategy. First, perform comprehensive spatiotemporal expression analysis using whole-mount in situ hybridization and immunohistochemistry across developmental stages to identify tissues with significant tmem93 expression. Second, generate tissue-specific knockdown or knockout of tmem93 using either electroporation of CRISPR components into specific blastomeres fated to become particular tissues or by creating transgenic lines with tissue-specific promoters driving Cas9 expression. Third, implement targeted RNA sequencing of distinct tissues from wild-type versus tmem93-disrupted embryos to identify tissue-specific transcriptional consequences. Fourth, conduct tissue-specific rescue experiments by expressing tmem93 under tissue-specific promoters in globally tmem93-deficient backgrounds to determine which phenotypes can be rescued by restricted expression. Fifth, perform tissue transplantation experiments between wild-type and tmem93-deficient embryos to distinguish cell-autonomous versus non-autonomous requirements. Sixth, employ tissue-specific proteomics using BioID or APEX2 proximity labeling to identify tissue-specific interaction partners. Finally, implement detailed tissue-specific phenotyping focusing on cellular morphology, ultrastructure, and function using techniques such as transmission electron microscopy for ER structure, calcium imaging for ER function, and tissue-specific functional assays. This comprehensive approach can reveal whether tmem93 functions uniformly across tissues or has specialized roles in particular developmental contexts .

What are the most promising approaches for studying potential roles of tmem93 in Xenopus metamorphosis?

The most promising approaches for studying potential roles of tmem93 in Xenopus metamorphosis combine genetic manipulation, molecular analysis, and physiological assessment throughout this remarkable developmental transition. First, generate tmem93-disrupted animals using optimized CRISPR-Cas9 techniques and carefully track metamorphic progression using standardized staging criteria, paying particular attention to processes involving tissue remodeling where ER functions might be critical. Second, perform detailed temporal expression profiling of tmem93 across metamorphic stages in multiple tissues, particularly those undergoing significant remodeling (intestine, tail, limbs, skin) using qRT-PCR and in situ hybridization. Third, analyze responsiveness to exogenous thyroid hormone (T3) in pre-metamorphic tadpoles, comparing wild-type and tmem93-disrupted animals across multiple metamorphic endpoints, similar to established protocols for thyroid hormone receptor studies. Fourth, examine potential molecular interactions between tmem93/EMC and thyroid hormone signaling components using co-immunoprecipitation and proximity labeling techniques. Fifth, analyze the ER stress response in remodeling tissues during metamorphosis in wild-type versus tmem93-disrupted animals, testing the hypothesis that tmem93 might buffer ER stress during this period of high protein synthesis and turnover. Finally, implement tissue-specific rescue approaches to determine if particular metamorphic processes require tmem93 function in specific cell types. This integrated approach can reveal whether tmem93 contributes to the complex cellular remodeling processes during metamorphosis, potentially through its role in ER membrane protein biogenesis .

What are the major research gaps in understanding tmem93 function in amphibian development?

Despite progress in characterizing the Xenopus tropicalis tmem93 protein, significant research gaps remain that limit our comprehensive understanding of its function in amphibian development. First, while the protein has been successfully expressed and purified, its precise membrane topology and structural features remain poorly defined, particularly how these compare to mammalian orthologs. Second, the developmental expression pattern of tmem93 across embryonic stages, tissues, and metamorphosis has not been systematically characterized, creating a fundamental knowledge gap about when and where this protein functions. Third, the composition and stoichiometry of the ER membrane complex (EMC) in Xenopus remains largely unexplored, including whether tmem93/emc6 interaction partners are conserved with mammalian systems. Fourth, specific developmental processes requiring tmem93 function have not been identified through loss-of-function studies, leaving questions about its developmental necessity unanswered. Fifth, potential genetic redundancy mechanisms that might compensate for tmem93 loss remain uninvestigated. Sixth, the potential role of tmem93 in metamorphosis-associated tissue remodeling, where extensive membrane protein biogenesis occurs, represents an intriguing but unexplored research area. Finally, the relationship between tmem93 and thyroid hormone signaling pathways during development and metamorphosis requires investigation, particularly given established protocols for studying hormone receptors in this context. Addressing these gaps through systematic experimental approaches will significantly advance understanding of this protein's developmental functions .

How might emerging technologies enhance future studies of tmem93 in Xenopus models?

Emerging technologies are poised to revolutionize studies of tmem93 in Xenopus models across multiple research dimensions. First, advanced genome editing technologies beyond traditional CRISPR-Cas9, such as base editors and prime editors, will enable precise introduction of patient-specific mutations without double-strand breaks, creating more accurate disease models. Second, single-cell multi-omics approaches combining scRNA-seq, scATAC-seq, and spatial transcriptomics will reveal cell type-specific functions of tmem93 with unprecedented resolution, mapping its role across developmental landscapes. Third, advances in cryo-electron microscopy optimized for membrane proteins will facilitate structural determination of Xenopus tmem93 within native complexes, potentially revealing species-specific features. Fourth, optogenetic and chemogenetic tools adapted for Xenopus will enable acute manipulation of tmem93 function with spatiotemporal precision during developmental events. Fifth, organoid technologies derived from Xenopus tissues will bridge the gap between in vivo developmental studies and translational applications, providing simplified systems for mechanistic studies. Sixth, CRISPR activation/interference (CRISPRa/CRISPRi) systems will allow modulation of tmem93 expression levels without protein ablation, addressing dosage-sensitive functions. Finally, artificial intelligence approaches for image analysis and phenotype classification will enable high-throughput screening of tmem93 variants and potential therapeutic interventions. Collectively, these technologies will transform our ability to dissect tmem93 functions in normal development and disease contexts, potentially revealing unexpected roles beyond its established function in the ER membrane complex .