Recombinant Xenopus tropicalis Transmembrane protein FAM155B (fam155b)

Shipped with Ice Packs
In Stock

Description

Production and Validation

Recombinant Production:

  • Expressed in E. coli systems with affinity tags (e.g., GST or His) for purification .

  • Available in liquid or lyophilized powder forms .

  • Endotoxin levels: <1.0 EU/µg (LAL method) .

Quality Control:

  • Validated via SDS-PAGE and Western blot (data not shown but standard for recombinant proteins) .

  • Functional associations include interactions with immune-related proteins (e.g., C3, SH2B3) in humans, suggesting conserved roles .

Applications in Research

  • ELISA: Used as an antigen or standard in immunoassays to study antibody interactions .

  • Functional Studies: Investigates roles in ion channel regulation or immune pathways, inferred from human FAM155B interactions .

  • Model Organism Research: Xenopus tropicalis serves as a key vertebrate model for developmental biology, making this protein valuable for comparative studies .

Research Findings and Clinical Relevance

Expression Patterns:

  • Highly expressed in brain, heart, and thyroid tissues in humans, suggesting conserved tissue-specific roles .

  • Differential expression noted in cancer studies:

    • Overexpressed in breast cancer cell lines .

    • Linked to BRAF kinase mutations in papillary thyroid cancer .

Evolutionary Conservation:

  • Orthologs exist in vertebrates (e.g., zebrafish, humans) and distantly in cnidarians .

  • Paralogs (e.g., FAM155A) share ~46% amino acid identity, indicating functional divergence .

Future Directions

  • Functional Elucidation: Mechanistic studies to define its role in ion transport or immune regulation.

  • Therapeutic Targeting: Explore its potential as a biomarker in cancers or immune disorders.

  • Structural Studies: Resolve 3D architecture to identify binding sites for drug design.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional fee. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize developing it accordingly.
Synonyms
fam155b; Transmembrane protein FAM155B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
fam155b
Target Protein Sequence
MIRGAWMYPREDEAVLKICWEPRHSDKPCADSERAQRWRMSLASLLFFTVLLSNHLWLVS AGAKARGSFTFSLQPANSSLLPPQSFPGEGRGCWDTFLSNLTKSAAQPPHCTGVRSTHLD TACAKLHYLQRHRGSFSPSYPQPSSWSSSYWSYPPSSFSSKRNFLKAYFRNYTLSFCDTY TILDLLLGMSNPDSLDCSLESLMEDFVGAAAASPALIEGEVCSSCIQAYQRLDQHAQEKY EEFDFVLEKYLQSGEYSVRSCVGDCKAVYKAWLCSEYFNVTQRQCRHRIPCKQYCLEVQT RCPFMLPDNDDLIYGGLPGFICTDMLENHMSNTEAECCDVRWHSCKTQGSGNHNTSTKST DSRFKYYPHHQHHRDHHLHPYHHQHHQSLLPVSAGSRLGNTRLRLCVLVLMLLHTMASFS VVQNGVTLEPLPGLDDSSSHEE
Uniprot No.

Target Background

Database Links
Protein Families
FAM155 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM155B and what is its structure in Xenopus tropicalis?

FAM155B (Family with sequence similarity 155 member B) is a transmembrane protein found in Xenopus tropicalis, also known as the Western clawed frog or Silurana tropicalis. The full-length protein consists of 442 amino acids with multiple transmembrane domains . The protein has a Uniprot accession number of A4IHZ3 and contains several notable structural features including:

  • A transmembrane domain structure characteristic of membrane-spanning proteins

  • Specific amino acid sequences that are conserved across species

  • Potential post-translational modification sites

The amino acid sequence includes regions with specific functional importance, particularly in the transmembrane segments. The protein contains cysteine-rich domains that suggest potential involvement in protein-protein interactions or structural stability through disulfide bonds .

What expression systems are used to produce recombinant Xenopus tropicalis FAM155B?

Recombinant Xenopus tropicalis FAM155B can be produced using several expression systems, each with specific advantages depending on research requirements. The most common systems include:

  • Bacterial expression systems: While cost-effective, these systems may struggle with proper folding of complex transmembrane proteins like FAM155B.

  • Insect cell expression systems: These provide superior post-translational modifications and are particularly suitable for transmembrane proteins. Baculovirus-infected insect cells can produce functional FAM155B with proper membrane insertion .

  • Mammalian cell expression systems: These offer the most native-like post-translational modifications but at higher cost.

For experimental applications requiring high purity, recombinant FAM155B typically undergoes chromatographic purification steps. Researchers often use affinity tags (such as His-tags) to facilitate purification, though these must be carefully designed to avoid disrupting protein function .

How does FAM155B compare between Xenopus tropicalis and other model organisms?

Comparative analysis of FAM155B across species reveals both conservation and divergence:

  • Sequence homology: Human FAM155B shares significant sequence similarity with the Xenopus tropicalis ortholog, particularly in the transmembrane domains and functional motifs.

  • Functional conservation: The human FAM155B protein appears to interact with sodium channel components including UNC79, NALCN, and UNC80, suggesting potential roles in ion channel regulation .

  • Evolutionary conservation: The preservation of FAM155B across vertebrate species indicates important biological functions, potentially in neuronal excitability and ion homeostasis.

This conservation makes Xenopus tropicalis an excellent model for studying the fundamental functions of FAM155B that may apply to higher vertebrates including humans. The genetic tractability of X. tropicalis, with its diploid genome (unlike the tetraploid X. laevis), makes it particularly valuable for genetic studies of FAM155B function .

What methods are optimal for storage and handling of recombinant FAM155B?

For optimal preservation of recombinant FAM155B structural integrity and biological activity, researchers should follow these storage and handling protocols:

  • Storage buffer: The protein demonstrates best stability in Tris-based buffer with 50% glycerol, specifically optimized for FAM155B .

  • Storage temperature: Long-term storage should be at -20°C or -80°C, while working aliquots can be maintained at 4°C for up to one week .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided to prevent protein degradation and activity loss .

  • Working conditions: When designing experiments, researchers should consider the buffer conditions that maintain FAM155B stability, including pH, ionic strength, and the presence of reducing agents that might affect disulfide bonds.

What protein interactions has FAM155B been shown to participate in, and what are their functional implications?

Based on protein interaction data primarily from the human ortholog, FAM155B appears to participate in a complex network of interactions with proteins involved in ion channel function:

  • NALCN complex: FAM155B interacts with components of the NALCN sodium channel complex, which forms a voltage-independent, cation-nonselective channel permeable to sodium, potassium, and calcium ions .

  • UNC79 and UNC80: These proteins are components of the NALCN complex and show strong interaction scores with FAM155B (0.627 and 0.498 respectively) . These interactions suggest FAM155B may be involved in regulating neuronal excitability.

  • ZC4H2: This zinc finger protein (interaction score 0.504) plays roles in interneuron differentiation and neuromuscular junction formation .

The interaction network suggests FAM155B may function as a regulatory component of sodium leak channels that control resting membrane potential in neurons. Experimental approaches to validate these interactions in Xenopus tropicalis could include co-immunoprecipitation, proximity ligation assays, or FRET-based interaction studies in Xenopus oocytes or embryonic tissues.

What genetic approaches can be used to study FAM155B function in vivo in Xenopus tropicalis?

Xenopus tropicalis offers several genetic approaches for investigating FAM155B function:

  • Morpholino antisense oligonucleotides: These can block translation of FAM155B mRNA, providing transient knockdown during early development . This approach has been successfully used to study various proteins in Xenopus, including β-catenin.

  • CRISPR/Cas9 genome editing: Modern genome editing techniques can be applied to X. tropicalis to generate knockout or knockin lines. This approach is particularly valuable given the diploid genome of X. tropicalis, which simplifies genetic analysis compared to the tetraploid X. laevis .

  • Zinc-finger nucleases: These have been successfully used to induce mutations in X. tropicalis genes (such as noggin) and could be applied to FAM155B .

  • Transgenic reporter lines: Similar to the GFP reporter lines developed for γ1-crystallin , transgenic approaches could be used to monitor FAM155B expression patterns during development.

  • TILLING approaches: Targeting Induced Local Lesions in Genomes can identify mutations in FAM155B from ENU-mutagenized animals .

For generating stable transgenic lines, researchers should consider sterilization protocols for embryos to prevent pathogen transmission, particularly important for establishing and maintaining valuable genetic lines .

How can the Xenopus oocyte expression system be used to study FAM155B function?

The Xenopus oocyte expression system offers powerful approaches for functional studies of FAM155B:

  • Electrophysiological characterization: Xenopus oocytes have been extensively used to study ion channels and transporters . For FAM155B, researchers can co-express it with potential interacting partners like NALCN, UNC79, and UNC80 to study how FAM155B modulates channel properties.

  • Experimental protocol:

    • In vitro transcription of cRNAs encoding FAM155B and interacting proteins

    • Microinjection into defolliculated Xenopus oocytes

    • Two-electrode voltage clamp recordings to measure transmembrane currents

    • Pharmacological interventions to probe channel function

  • Advantages of the system:

    • Large cell size facilitates microinjection and recording

    • Low background of endogenous channels

    • Ability to control expression of multiple proteins simultaneously

    • Established protocols for membrane protein expression

This approach has been instrumental in identifying novel channels and transporters and would be particularly valuable for determining the functional effects of FAM155B on ion channel properties and neuronal excitability mechanisms .

How can protein-protein interaction studies be designed to investigate FAM155B binding partners?

To rigorously investigate FAM155B protein interactions, researchers can employ multiple complementary approaches:

  • Co-immunoprecipitation: Using antibodies against FAM155B to pull down protein complexes from Xenopus tissues or cells expressing recombinant proteins, followed by mass spectrometry to identify interacting partners.

  • Surface Plasmon Resonance (SPR): To determine binding kinetics and affinity constants. This technique could measure direct binding between purified FAM155B and potential partners like NALCN complex components, similar to how Chordin-BMP4 interactions were characterized with a KD of 3 × 10−10 M .

  • Proximity-dependent labeling: BioID or APEX2 fusion proteins can identify proteins in close proximity to FAM155B in living cells.

  • Yeast two-hybrid screening: Although this technique has limitations for transmembrane proteins, modified membrane yeast two-hybrid systems could be employed.

  • FRET/BRET approaches: These can detect protein interactions in living cells through fluorescence or bioluminescence resonance energy transfer.

Based on current knowledge of human FAM155B interactions, researchers should focus on components of the NALCN complex (UNC79, NALCN, UNC80) and ZC4H2 as primary candidates for interaction studies in Xenopus systems .

What challenges exist in studying transmembrane proteins like FAM155B and how can they be addressed?

Transmembrane proteins present several research challenges that require specific methodological approaches:

  • Protein purification challenges:

    • Limited solubility in aqueous buffers

    • Requirement for detergents or lipid environments

    • Potential for misfolding or aggregation

    Solution: Use mild detergents, nanodiscs, or amphipols to maintain protein structure during purification.

  • Structural analysis difficulties:

    • Challenges in crystallization for X-ray diffraction

    • Size limitations for NMR studies

    Solution: Consider cryo-EM approaches or computational modeling based on homology to better-characterized proteins.

  • Functional assays:

    • Maintaining native membrane environment for functional studies

    • Reconstitution into artificial membranes

    Solution: The Xenopus oocyte system provides an excellent native membrane environment for functional studies of transmembrane proteins like FAM155B .

  • Antibody generation:

    • Limited accessibility of epitopes in membrane-embedded regions

    Solution: Focus on extracellular or cytoplasmic domains for antibody generation, or use epitope tags in recombinant constructs.

  • In vivo imaging:

    • Visualizing membrane protein localization and trafficking

    Solution: Generate fluorescent protein fusions with careful design to avoid disrupting membrane insertion, following strategies developed for other Xenopus proteins like crystallin-GFP .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.