Recombinant Xenopus tropicalis Trimeric intracellular cation channel type B (tmem38b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem38b; TEgg035c21.1; Trimeric intracellular cation channel type B; TRIC-B; TRICB; Transmembrane protein 38B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem38b
Target Protein Sequence
MESFSELSLQFSQLSMFPFFETAHYLTSVMSAREQAGAVDVASRSPLASWFSSMLYCFGG GILSSILLAEPPVGILSNTTSIILASAVWYMVYYFPYDLFYNCFFFLPIRLILAGMKEVT RTWKILSGVAHAHSHYKDAMLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGQYLPISRHNLMFIYTLFLILIKVTMMLTRSTASPFLPLETSLQ HILFSRQQIPAEVRESPSSSGDKGKPSKKTLDKDSGEQDNKKDN
Uniprot No.

Target Background

Function
A monovalent cation channel crucial for maintaining rapid intracellular calcium release. It may function as a potassium counter-ion channel, synchronizing with calcium release from intracellular stores.
Database Links
Protein Families
TMEM38 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is tmem38b and what is its primary function in cellular physiology?

Tmem38b (Trimeric Intracellular Cation Channel Type B or TRIC-B) is an endoplasmic reticulum (ER) integral membrane protein that plays a crucial role in regulating calcium release from the ER. While TRIC-A is primarily involved in regulating calcium release mediated by ryanodine receptors (RyRs) in excitable cells, TRIC-B modulates calcium release through inositol 1,4,5-trisphosphate receptors (IP3Rs) . Unlike the tissue-specific expression of TRIC-A, TRIC-B is ubiquitously distributed at moderate levels throughout various tissues . Its function is essential for maintaining proper calcium homeostasis within the ER, which directly impacts multiple cellular processes including collagen modification and processing.

How does the structure of Xenopus tropicalis tmem38b compare to its mammalian counterparts?

Xenopus tropicalis tmem38b shares significant structural homology with mammalian TRIC-B proteins. The full-length protein consists of 284 amino acids (1-284aa) in Xenopus tropicalis . Key structural features include conserved transmembrane domains that form the channel pore and the highly conserved KEV domain, which is critical for proper protein function . Research using zebrafish models has demonstrated that deletion of this KEV domain results in functional impairment, suggesting evolutionary conservation of critical functional domains across vertebrate species . This structural conservation makes Xenopus tropicalis an excellent model for studying the basic biology of TRIC-B channels with translational relevance to mammalian systems.

What are the expression patterns of tmem38b during Xenopus tropicalis development?

Studies in zebrafish, which serve as a comparative model to Xenopus, have demonstrated that tmem38b has maternal expression and is actively expressed at early developmental stages . While specific expression patterns in Xenopus tropicalis have not been fully characterized in the provided sources, the gene likely follows similar developmental timing given the conserved nature of these channels across vertebrates. The ubiquitous distribution of TRIC-B across tissues suggests that in Xenopus tropicalis, this channel would be expressed in multiple developing organ systems, with particular importance in tissues requiring active calcium regulation, such as the developing skeletal system.

What advantages does Xenopus tropicalis offer as a model system for studying tmem38b compared to other vertebrate models?

Xenopus tropicalis presents several distinct advantages for tmem38b research compared to other vertebrate models:

  • Diploid genome: Unlike the allotetraploid Xenopus laevis, X. tropicalis possesses a diploid genome that diverged approximately 50 million years ago from X. laevis . This diploid nature simplifies genetic analyses and makes it more comparable to mammalian systems.

  • Shorter generation time: X. tropicalis has a significantly shorter generation time than X. laevis, facilitating multigenerational experiments crucial for genetic studies .

  • Genome sequence availability: The X. tropicalis genome was sequenced before X. laevis, providing an indispensable resource for all Xenopus researchers . This genomic data facilitates precise genetic manipulation and analysis of tmem38b.

  • Remarkable synteny with mammalian genomes: X. tropicalis shows extensive synteny with mammalian genomes, often in stretches of a hundred genes or more, far greater than that seen between fish and mammals . This conservation enhances the translational relevance of findings.

  • Ease of tissue manipulation: The Xenopus system allows researchers to readily create tissue chimeras, enabling the determination of whether phenotypic defects are due to gene lesions acting within specific tissues or failures in inductive signals from adjacent tissues .

How can genetic approaches in Xenopus tropicalis advance our understanding of tmem38b function?

Genetic approaches in Xenopus tropicalis offer powerful tools for elucidating tmem38b function:

  • Forward genetic screens: The ability to perform gynogenetic screening in X. tropicalis allows for efficient identification of recessive mutations affecting tmem38b or related pathways . This process involves generating haploid embryos with only maternal genetic material, then diploidizing them through cold shock protocols, which reveals recessive mutations more rapidly than traditional three-generation screening methods .

  • CRISPR/Cas9 gene editing: As demonstrated in zebrafish models, targeted mutations can be generated in tmem38b using CRISPR/Cas9 technology to create specific lesions, such as premature stop codons or domain deletions . Similar approaches in X. tropicalis would allow precise manipulation of the gene.

  • Positional cloning: The availability of reliable genetic maps based on simple sequence length polymorphisms (SSLPs) facilitates mapping and cloning of mutations in X. tropicalis . Gynogenetic mapping further helps identify the chromosome on which a particular mutation lies .

  • Transgenic approaches: The development of sophisticated transgenic technologies in X. tropicalis enables controlled manipulation of gene expression, which is valuable for studying tmem38b regulation and function in specific tissues or developmental stages .

What are the optimal conditions for expression and purification of recombinant Xenopus tropicalis tmem38b protein?

Based on established protocols for recombinant Xenopus tropicalis tmem38b protein expression and purification:

  • Expression system: E. coli has been successfully used as an expression system for the full-length recombinant protein (amino acids 1-284) .

  • Tagging strategy: N-terminal His-tagging has proven effective for purification purposes .

  • Purification: Standard affinity chromatography using His-tag specific resins is recommended, followed by quality assessment via SDS-PAGE to confirm purity greater than 90% .

  • Storage recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • For long-term storage, add glycerol to a final concentration of 5-50% (recommended 50%)

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For storage, add glycerol to desired final concentration (5-50%)

    • Aliquot for long-term storage at -20°C/-80°C

What methods are most effective for studying tmem38b function in Xenopus tropicalis oocytes and embryos?

Several complementary approaches have proven effective for investigating tmem38b function in amphibian models:

  • Calcium imaging: Since tmem38b regulates calcium flux from the ER, fluorescent calcium indicators can be used to monitor calcium dynamics in Xenopus oocytes and embryonic cells, comparing wild-type and tmem38b-deficient samples.

  • Electrophysiology: Patch-clamp recordings of ER membranes can directly measure channel activity and characterize how mutations affect ion conductance properties.

  • Morpholino knockdown: Antisense morpholinos can be injected into early embryos to temporarily reduce tmem38b expression during specific developmental windows.

  • CRISPR/Cas9 mutagenesis: As demonstrated in zebrafish models, creating targeted mutations in the tmem38b gene can produce informative phenotypes. Two effective approaches include:

    • Creating frameshift mutations that introduce premature stop codons

    • Generating in-frame deletions that remove critical functional domains like the KEV domain

  • Transgenic reporter lines: Creating transgenic Xenopus lines with fluorescent reporters driven by the tmem38b promoter enables visualization of spatiotemporal expression patterns.

What techniques can be used to investigate the interaction between tmem38b and collagen processing in Xenopus tropicalis?

To investigate tmem38b's role in collagen processing within Xenopus tropicalis, researchers can employ the following techniques:

  • Immunofluorescence microscopy: To visualize collagen localization and determine whether it is properly secreted or abnormally retained in the ER in tmem38b-deficient cells, as observed in zebrafish models .

  • Biochemical analysis of collagen modifications: Techniques such as SDS-PAGE with delayed reduction can assess the post-translational modifications of collagen, including hydroxylation and glycosylation patterns.

  • Transmission electron microscopy: To examine ER morphology for evidence of stress or enlargement due to collagen retention, as observed in TRIC-B knockout mice that display enlarged ER cisternae .

  • Bone histology and mineralization assays: To assess the impact of tmem38b deficiency on skeletal development, as TRIC-B is essential for proper bone formation .

  • Gene expression profiling: RNA-seq analysis of wild-type versus tmem38b-mutant embryos can identify dysregulated genes involved in collagen synthesis, modification, and folding pathways.

How can tmem38b research in Xenopus tropicalis inform our understanding of osteogenesis imperfecta type XIV?

Research on tmem38b in Xenopus tropicalis provides valuable insights into the molecular mechanisms underlying osteogenesis imperfecta type XIV:

  • Collagen modification studies: TRIC-B deficiency causes dysregulation of calcium flux from the ER, impacting collagen-specific chaperones and modifying enzymes . Xenopus models can help elucidate the precise sequence of molecular events from calcium dysregulation to collagen undermodification.

  • Bone cell differentiation: Studies in other models have shown that osteoblasts from TRIC-B knockout mice display intracellular collagen retention , while human OI type XIV osteoblasts show altered expression of differentiation markers . Xenopus tropicalis can serve as a complementary model to investigate these processes during embryonic and larval development.

  • Regenerative capacity: Xenopus, like zebrafish, possesses significant regenerative capabilities. Studies of fin regeneration in zebrafish tmem38b mutants have revealed impaired activity of both osteoblasts and osteoclasts associated with mineralization defects . Similar studies in Xenopus could provide insights into regenerative processes relevant to bone healing in OI patients.

  • Tissue-specific requirements: Through tissue-specific gene knockdown or chimeric tissue experiments uniquely feasible in Xenopus, researchers can determine whether skeletal phenotypes arise from intrinsic defects in bone cells or from disrupted signaling from surrounding tissues.

What are the current challenges in analyzing calcium dynamics in relation to tmem38b function in Xenopus tropicalis?

Researchers face several challenges when studying calcium dynamics related to tmem38b function:

  • Subcellular resolution: Since tmem38b functions specifically at the ER membrane, standard calcium imaging may lack the spatial resolution to distinguish ER calcium flux from other intracellular calcium signals. Advanced techniques such as genetically encoded calcium indicators targeted to the ER lumen or ER-plasma membrane junction sites are needed.

  • Temporal dynamics: Calcium signals often occur in complex oscillatory patterns. Capturing these dynamics requires high-speed imaging equipment and sophisticated analysis algorithms to detect subtle changes in signal patterns between wild-type and tmem38b-deficient samples.

  • Tissue-specific effects: The ubiquitous expression of tmem38b means its role may vary across different tissues. Developing methods to monitor calcium dynamics in specific cell types within intact embryos presents technical challenges.

  • Compensatory mechanisms: Other calcium regulatory proteins may compensate for tmem38b deficiency, masking phenotypes. Careful analysis of related channels (such as tmem38a/TRIC-A) and their potential upregulation in tmem38b mutants is necessary .

  • Developmental timing: The contribution of maternal tmem38b transcripts observed in zebrafish suggests that complete functional analysis requires both maternal and zygotic knockdown approaches.

How might high-throughput screening approaches be adapted for identifying compounds that modulate tmem38b function in Xenopus tropicalis?

High-throughput screening for tmem38b modulators can be adapted for Xenopus tropicalis using the following approaches:

  • Embryo-based phenotypic screens: Utilizing tmem38b mutant or transgenic reporter lines, compounds can be screened for their ability to rescue or exacerbate developmental phenotypes. Key assays might include:

    • Bone mineralization assays using fluorescent calcein staining

    • Collagen processing assessment via fluorescently tagged collagen reporters

    • Survival and developmental progression metrics

  • Oocyte-based electrophysiological screens: Xenopus oocytes overexpressing tmem38b can be used in automated patch-clamp platforms to identify compounds that directly modulate channel activity.

  • Cell-based calcium imaging: Primary cells from Xenopus embryos can be cultured in multi-well formats for calcium imaging screens to identify compounds that restore normal calcium dynamics in tmem38b-deficient cells.

  • In vitro protein interaction screens: Using purified recombinant Xenopus tropicalis tmem38b protein , compound libraries can be screened for molecules that stabilize protein structure or promote interaction with known binding partners.

  • Computational pre-screening: Molecular docking studies using the resolved or predicted structure of Xenopus tropicalis tmem38b can identify candidate compounds with high binding probability for subsequent validation in biological assays.

What are common challenges in expressing and purifying functional recombinant Xenopus tropicalis tmem38b protein, and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Xenopus tropicalis tmem38b:

  • Protein solubility issues: As an integral membrane protein, tmem38b can form inclusion bodies during bacterial expression.

    • Solution: Optimize expression conditions by reducing temperature (16-18°C), using specialized E. coli strains designed for membrane proteins, or adding solubility enhancers to the culture medium.

  • Protein misfolding: Incorrect folding can result in non-functional protein.

    • Solution: Consider expression systems that better support proper folding of eukaryotic membrane proteins, such as insect cells or mammalian cells, as alternatives to E. coli.

  • Low yield: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Scale up culture volume, optimize induction conditions, or consider fusion partners known to enhance expression levels.

  • Protein degradation during purification: Proteolytic degradation can reduce yield and quality.

    • Solution: Include protease inhibitors throughout the purification process and minimize time between lysis and final storage. Keep samples cold during all purification steps.

  • Maintaining native conformation: Detergents used during purification may disrupt protein structure.

    • Solution: Screen multiple detergents at various concentrations to identify conditions that maintain protein functionality. Consider native nanodiscs or amphipols for stabilizing the purified protein.

How can researchers troubleshoot experiments involving tmem38b gene editing in Xenopus tropicalis?

When performing gene editing experiments targeting tmem38b in Xenopus tropicalis, consider these troubleshooting approaches:

  • Low editing efficiency:

    • Optimize guide RNA design using Xenopus-specific algorithms

    • Test multiple guide RNAs targeting different regions of the gene

    • Adjust Cas9 protein and guide RNA concentrations

    • Verify editing efficiency using T7 endonuclease assays or direct sequencing

  • Off-target effects:

    • Use highly specific guide RNAs with minimal predicted off-target sites

    • Perform whole genome sequencing on founder animals to identify potential off-target mutations

    • Generate and compare multiple independent mutant lines to distinguish phenotypes caused by on-target versus off-target effects

  • Embryonic lethality:

    • Consider using inducible or tissue-specific Cas9 expression systems

    • Generate hypomorphic alleles rather than complete knockouts

    • Create specific domain deletions (as demonstrated in zebrafish with the KEV domain deletion )

  • Phenotypic variability:

    • Account for genetic background effects by backcrossing to a standard inbred line

    • Consider maternal contribution of tmem38b, as observed in zebrafish

    • Standardize environmental conditions during development

  • Genotype-phenotype correlation:

    • Establish quantitative phenotyping methods

    • Compare multiple alleles with different mutation types

    • Consider compensatory upregulation of paralogs like tmem38a

What quality control measures should be implemented when working with Recombinant Xenopus tropicalis tmem38b protein?

To ensure experimental reliability when working with recombinant Xenopus tropicalis tmem38b protein, implement these quality control measures:

  • Purity assessment:

    • Confirm purity greater than 90% using SDS-PAGE

    • Consider additional analytical techniques such as size exclusion chromatography or mass spectrometry for higher resolution analysis

  • Identity verification:

    • Perform Western blotting with specific antibodies

    • Conduct peptide fingerprinting via mass spectrometry

    • Confirm sequence integrity through N-terminal sequencing

  • Functional validation:

    • Assess channel activity through reconstitution in liposomes and electrophysiological recording

    • Verify calcium binding capability through isothermal titration calorimetry

    • Test interaction with known binding partners through pull-down assays

  • Stability monitoring:

    • Implement a regular testing schedule for stored protein

    • Avoid repeated freeze-thaw cycles by preparing appropriate aliquots

    • Monitor protein over time for signs of degradation or aggregation

  • Batch consistency:

    • Maintain detailed records of expression and purification conditions

    • Compare new batches against reference standards

    • Develop functional assays that can detect batch-to-batch variation

What emerging technologies might enhance our understanding of tmem38b function in Xenopus tropicalis?

Several cutting-edge technologies hold promise for advancing tmem38b research:

  • Cryo-electron microscopy: Determining the high-resolution structure of Xenopus tropicalis tmem38b would provide unprecedented insights into channel architecture and the molecular basis of calcium regulation.

  • Single-cell transcriptomics: Applying scRNA-seq to tmem38b mutant embryos could reveal cell type-specific responses to channel dysfunction and identify compensatory pathways.

  • Optogenetic calcium modulation: Developing tools to precisely control ER calcium release in specific tissues would help dissect the temporal requirements for tmem38b function during development.

  • Genome-wide CRISPR screens: Using pooled CRISPR libraries to identify genetic modifiers of tmem38b phenotypes could uncover novel components of calcium signaling pathways.

  • Advanced imaging techniques: Super-resolution microscopy and live imaging approaches could visualize tmem38b localization and dynamics within the ER membrane at unprecedented resolution.

  • Tissue-specific gene editing: New methods for conditional gene editing in Xenopus would enable investigation of stage- and tissue-specific requirements for tmem38b function.

How might comparative studies between Xenopus tropicalis tmem38b and orthologs in other species inform therapeutic approaches for osteogenesis imperfecta?

Comparative evolutionary studies offer valuable insights for therapeutic development:

  • Functional conservation analysis: Determining which domains and residues of tmem38b are most conserved across species can identify critical regions that should be targeted or preserved in therapeutic approaches.

  • Species-specific compensatory mechanisms: Some species may have evolved redundant pathways that could be therapeutically activated in humans. For example, studying whether tmem38a can compensate for tmem38b loss in different species might reveal potential therapeutic targets.

  • Natural variants with improved function: Identifying species with enhanced calcium handling or collagen processing capabilities could reveal naturally optimized versions of the channel with therapeutic potential.

  • Cross-species rescue experiments: Testing whether the human TMEM38B gene can rescue phenotypes in Xenopus tropicalis tmem38b mutants, and vice versa, would validate conserved functionality and support translational approaches.

  • Differential sensitivity to stressors: Comparing how tmem38b orthologs respond to cellular stresses (oxidative stress, ER stress, mechanical strain) across species could identify conserved stress-response pathways amenable to therapeutic intervention.

What are the implications of recent findings about tmem38b for regenerative medicine applications?

Recent discoveries about tmem38b function have significant implications for regenerative medicine:

  • Bone regeneration: Studies in zebrafish have shown that tmem38b mutants display impaired bone cell function during fin regeneration . Understanding these mechanisms could inform strategies to enhance bone healing in conditions like osteogenesis imperfecta or fracture repair.

  • ER stress modulation: Since tmem38b deficiency leads to collagen retention and ER stress , therapies targeting this pathway could potentially improve cellular function in multiple tissues with high collagen production.

  • Calcium signaling in stem cells: Given the fundamental role of calcium signaling in stem cell differentiation, insights from tmem38b research could inform approaches to direct differentiation of pluripotent cells toward specific lineages.

  • Collagen processing enhancement: Therapies aimed at improving collagen modification and secretion could benefit from targeting the tmem38b-regulated calcium pathways.

  • Tissue engineering: Understanding how tmem38b influences extracellular matrix organization could inform the development of improved scaffolds for tissue engineering applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.