Recombinant Xenopus tropicalis Tripartite motif containing 13 (trim13)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus tropicalis Tripartite Motif Containing 13 (trim13)

Recombinant Xenopus tropicalis Tripartite motif-containing 13 (trim13) is a synthesized version of the trim13 protein found in the Western clawed frog (Xenopus tropicalis) . TRIM13, a member of the TRIM family, functions as an E3 ubiquitin ligase, participating in various cellular processes, including cell death, antiviral immunity, and cancer-related pathways .

Applications and Research Findings

  • Study of Immune Genes: Xenopus is used to validate and improve the annotation of immune genes within its genome .

  • Microplastic Impact Studies: Xenopus serves as a model to study the effects of microplastics on antimicrobial immunity .

  • Antiviral Research: Overexpression of trim13 in fish cells enhances the replication of certain viruses, suggesting its role in antiviral response regulation .

TRIM13 in Other Species

TRIM13 homologs in other species also play roles in immune regulation and disease:

  • Grouper (Epinephelus coioides): Grouper TRIM13 negatively regulates antiviral immune response against nodavirus infection .

  • Human: In human lung adenocarcinoma cells, TRIM13 acts as a tumor suppressor and induces autophagy .

  • Shrimp: Shrimp TRIM50-like is required for autophagy and restricts the proliferation of the white spot syndrome virus (WSSV) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
trim13; Tripartite motif containing 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
trim13
Target Protein Sequence
MEVLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLDGVLEENSRTMQWRPSSFKCPTCRKE TPTMGVNGLQVNYLLKGIVEKYNKIKVSPKMPVCKEHSDQPLNIFCSTDLKLICGSCATT GEHKKHVFSSIGDAYIQEKSSLETLFQGVEEWNSKEVHSHLDTLESNKRKALHSLAKESD KVKAYFEKLQYLLEQKKNEILSDFETLKLAVMQAYDTEINKLHTVLSEQRKACNIVEDLK NISDPFMFLQQMQEFRDKMTFIKEAPLTTGQDVNVNPAMKEFDTSMWDSIKLGEVDKLSL PQDTTSKKEPGDAKTLHSLKPILVVACLILLLVTFLCAYPFIDSLPTFTIDLQVISSYFF TTTAKAANLTILFWEQLSEELLILKQRCQTYVSVFLENVAEFVCKYKL
Uniprot No.

Target Background

Function

Recombinant Xenopus tropicalis Tripartite Motif Containing 13 (TRIM13) is an E3 ubiquitin ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the endoplasmic reticulum (ER) via ER-associated degradation (ERAD). This process targets both misfolded and correctly folded proteins for regulated degradation.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is TRIM13 and what is its function in Xenopus tropicalis?

TRIM13 belongs to the tripartite motif family characterized by RING finger domains, B-box domains, and coiled-coil regions. In Xenopus tropicalis, as in other vertebrates, TRIM13 likely functions as an E3 ubiquitin ligase due to its conserved RING domain. Based on studies in mammals, TRIM13 interacts with melanoma differentiation-associated protein 5 (MDA5) and negatively regulates MDA5-mediated type I interferon production . Similarly, in fish, TRIM13 exerts negative regulation of antiviral responses against nodavirus infection . These functions may be conserved in Xenopus tropicalis, though specific validation is necessary.

How conserved is TRIM13 across species compared to Xenopus tropicalis?

TRIM13 exhibits moderate to high conservation across vertebrate species. While the search results don't provide specific information about Xenopus tropicalis TRIM13, we can infer from other species data. For instance, grouper TRIM13 shares 81% identity with large yellow croaker TRIM13 . Phylogenetic analyses typically show that TRIM13 proteins from fish species cluster together, separated from amphibians, birds, and mammals, suggesting evolutionary divergence while maintaining core structural elements . Examining Xenopus tropicalis TRIM13 sequence homology with other vertebrates would help determine the degree of functional conservation.

What domains are present in Xenopus tropicalis TRIM13?

Based on the conserved nature of TRIM family proteins, Xenopus tropicalis TRIM13 likely contains:

  • A RING finger domain at the N-terminus (responsible for E3 ubiquitin ligase activity)

  • B-box zinc finger domain(s)

  • A coiled-coil domain (important for protein-protein interactions)

  • Possibly additional C-terminal domains

Studies in grouper confirmed the presence of conserved RING finger and B-box domains in fish TRIM13 . The RING domain is particularly critical as it mediates the transfer of ubiquitin to substrate proteins, marking them for degradation or altering their function.

What is the tissue-specific expression pattern of TRIM13 in Xenopus tropicalis?

While specific data for Xenopus tropicalis TRIM13 tissue distribution is not available in the search results, patterns from other vertebrates can guide investigation. In grouper fish, TRIM13 is predominantly expressed in liver, spleen, kidney, gill, and intestine . For Xenopus tropicalis research, it would be advisable to examine multiple tissues, particularly those associated with immune function like spleen and kidney, as well as liver and intestine. Expression patterns may also vary during developmental stages, making developmental time-course studies valuable.

How can I detect TRIM13 expression in Xenopus tropicalis tissues?

Multiple methods can be employed to detect TRIM13 expression:

  • Quantitative RT-PCR (qRT-PCR): Design primers specific to Xenopus tropicalis TRIM13. Based on protocols used for fish TRIM13, typical conditions might include:

    • Initial denaturation at 94°C for 5 min

    • 45 cycles of: 5s at 94°C, 10s at 60°C, and 15s at 72°C

    • Normalization to β-actin or other housekeeping genes

  • Western blotting: Use antibodies specific to Xenopus tropicalis TRIM13 or cross-reactive antibodies from closely related species.

  • In situ hybridization: For visualizing tissue-specific expression patterns during development.

  • RNA-seq analysis: For global transcriptomic profiling and comparative analysis.

What is the subcellular localization of TRIM13 in Xenopus tropicalis cells?

The subcellular localization of TRIM13 can provide insights into its function. In grouper cells expressing wild-type TRIM13-GFP fusion proteins, tubular structures were observed in the cytoplasm. Interestingly, when the RING domain was mutated, the localization pattern changed, with fluorescence evenly distributed throughout the cytoplasm . This suggests the RING domain is essential for proper localization.

To determine subcellular localization in Xenopus tropicalis cells:

  • Generate GFP-tagged TRIM13 constructs (both wild-type and domain mutants)

  • Transfect Xenopus tropicalis cell lines or primary cells

  • Fix cells with 4% paraformaldehyde

  • Counterstain nuclei with DAPI

  • Visualize using fluorescence or confocal microscopy

What is the role of TRIM13 in Xenopus tropicalis immune response?

Based on research in other species, TRIM13 likely plays a regulatory role in antiviral immune responses in Xenopus tropicalis. In humans, TRIM13 negatively regulates MDA5-mediated type I interferon production . Similarly, in grouper fish, overexpression of TRIM13 increased replication of red spotted grouper nervous necrosis virus (RGNNV) and negatively regulated interferon promoter activity induced by IRF3, IRF7, and MDA5 .

To investigate TRIM13's role in Xenopus tropicalis immune response:

  • Examine TRIM13 expression changes after viral challenge or poly I:C treatment

  • Perform overexpression and knockdown experiments to assess impact on viral replication

  • Measure changes in expression of immune-related genes including interferons and cytokines

  • Conduct reporter gene assays using interferon promoter constructs

How does TRIM13 interact with other immune signaling components in Xenopus tropicalis?

TRIM13 likely interacts with multiple components of immune signaling pathways. Studies in humans and fish have shown that TRIM13 interacts with MDA5 and can regulate IRF3/7-mediated signaling . To identify interaction partners in Xenopus tropicalis:

  • Co-immunoprecipitation (Co-IP) assays:

    • Express tagged TRIM13 in Xenopus cells

    • Immunoprecipitate using tag-specific antibodies

    • Identify co-precipitated proteins by mass spectrometry or western blotting

  • Luciferase reporter assays:

    • Co-transfect TRIM13 with known immune signaling components (MDA5, IRF3, IRF7)

    • Measure effects on interferon promoter activity, as done in grouper studies

    • Compare wild-type TRIM13 with RING domain mutants

How does TRIM13 regulate antiviral responses in Xenopus tropicalis?

The exact mechanisms by which TRIM13 regulates antiviral responses in Xenopus tropicalis would need direct investigation, but insights from other species suggest potential mechanisms:

  • Negative regulation of interferon production:

    • In fish, TRIM13 overexpression negatively regulated interferon promoter activity

    • In humans, TRIM13 negatively regulates MDA5-mediated type I IFN production

  • Regulation of immune signaling pathways:

    • TRIM13 may affect the expression of interferon-related factors

    • It could modulate the expression of pro-inflammatory cytokines

  • Viral replication effects:

    • In grouper cells, TRIM13 overexpression increased nodavirus replication

    • The RING domain appears essential for this function, suggesting E3 ligase activity involvement

What are the best methods to express recombinant Xenopus tropicalis TRIM13?

Expression of recombinant TRIM13 can be approached through several systems:

  • Bacterial expression system (E. coli):

    • Use BL21(DE3) or similar strains optimized for protein expression

    • Consider fusion tags that enhance solubility (MBP, SUMO, TrxA)

    • Express at lower temperatures (16-20°C) to improve folding

  • Insect cell expression (Baculovirus):

    • Often yields better results for eukaryotic proteins

    • Provides post-translational modifications

    • Use Sf9 or Hi5 cells with optimized vectors

  • Mammalian cell expression:

    • HEK293T or CHO cells for transient or stable expression

    • Useful when protein function depends on mammalian-specific modifications

For functional studies in fish, researchers have successfully expressed TRIM13 using pcDNA3.1-flag vector and pEGFP-N3 vector, creating both wild-type and RING domain mutant constructs . Similar approaches could be adapted for Xenopus tropicalis TRIM13.

How can I investigate the effects of TRIM13 on viral replication in Xenopus tropicalis?

To study TRIM13's impact on viral replication:

  • Overexpression studies:

    • Transfect Xenopus cells with TRIM13 expression constructs (wild-type and mutants)

    • Infect with relevant viruses

    • Measure viral gene expression by qRT-PCR

    • Compare viral titers between control and TRIM13-expressing cells

In fish studies, researchers overexpressed TRIM13 in grouper spleen cells, infected them with red spotted grouper nervous necrosis virus (RGNNV), and quantified viral coat protein (CP) and RNA-dependent RNA polymerase (RdRp) gene expression by qRT-PCR to assess viral replication .

  • Knockdown/knockout approaches:

    • Generate TRIM13 knockdown or knockout Xenopus cells

    • Challenge with viruses

    • Assess viral replication compared to control cells

  • Domain mutant analysis:

    • Express TRIM13 with mutations in functional domains (e.g., RING domain)

    • Determine which domains are essential for effects on viral replication

What controls should I include when studying TRIM13 function?

Proper controls are essential for reliable interpretation of results:

  • Genetic controls:

    • Wild-type TRIM13 expression construct

    • RING domain mutant (catalytically inactive) - particularly important as studies in fish showed the RING domain is essential for TRIM13 function

    • Empty vector control

    • Unrelated protein control (e.g., GFP alone)

  • Experimental controls for gene expression analysis:

    • Time course experiments to capture dynamic responses

    • Multiple cell types to assess context-dependent functions

    • Appropriate housekeeping genes for normalization (β-actin was used in fish studies)

  • Controls for functional assays:

    • For luciferase reporter assays: include positive control inducers

    • For viral infection studies: include known antiviral or proviral proteins as controls

    • Include concentration gradients of expression constructs to assess dose-dependent effects

How does TRIM13 function differ between cell types in Xenopus tropicalis?

The function of TRIM proteins can be highly cell type-dependent. In mammals, TRIM21 shows context-dependent function: it is essential for type I IFN production in embryonic fibroblasts but appears to be redundant in bone marrow-derived macrophages . Similarly, TRIM13 function may vary by cell type in Xenopus tropicalis.

To investigate cell type-specific functions:

  • Compare TRIM13 expression levels across different cell types

  • Examine effects of TRIM13 overexpression or knockdown on immune responses in different cell types

  • Investigate protein interaction partners in various cell contexts

  • Assess subcellular localization across cell types

The search results note that "if the cell type-specific function of TRIM21 and TRIM13 is a general feature of TRIM proteins, caution in the interpretation of results obtained with cell lines is warranted, and where possible, the in vivo impact of each TRIM in a setting of infection should be determined" .

How does TRIM13 expression change during Xenopus tropicalis development?

Developmental regulation of TRIM13 could provide insights into its broader biological functions beyond immunity. To study developmental expression:

  • Collect embryos at different developmental stages

  • Extract RNA and perform qRT-PCR for TRIM13

  • Alternatively, perform in situ hybridization to visualize spatial expression patterns

  • Compare with expression patterns of related immune components

This developmental analysis could reveal:

  • Tissue-specific expression patterns during organogenesis

  • Correlation with immune system development

  • Potential non-immune developmental functions

How do post-translational modifications affect TRIM13 function in Xenopus tropicalis?

Post-translational modifications (PTMs) likely regulate TRIM13 function. Potential approaches to study PTMs include:

  • Identification of modification sites:

    • Express and purify tagged TRIM13 from Xenopus cells

    • Analyze by mass spectrometry to identify phosphorylation, ubiquitination, SUMOylation, etc.

  • Functional impact of modifications:

    • Generate site-specific mutants (e.g., S/T to A for phosphorylation sites)

    • Compare activity of wild-type vs. mutant TRIM13 in functional assays

    • Assess the impact on localization, protein interactions, and E3 ligase activity

  • Regulatory pathways:

    • Identify kinases or other enzymes responsible for TRIM13 modifications

    • Investigate how cellular stresses or immune stimulation affects modification status

How does Xenopus tropicalis TRIM13 function compare to its mammalian counterparts?

Comparing TRIM13 functions across species can reveal evolutionary adaptations and conserved mechanisms:

  • Sequence and structural comparisons:

    • Align Xenopus, fish, and mammalian TRIM13 sequences

    • Identify conserved domains and species-specific variations

    • Generate phylogenetic trees to understand evolutionary relationships

  • Functional conservation testing:

    • Determine if Xenopus TRIM13 can complement mammalian TRIM13 knockout cells

    • Compare ability to regulate interferon responses across species

    • Assess conservation of protein interaction networks

In fish, TRIM13 negatively regulates type I interferon production , similar to human TRIM13 , suggesting functional conservation despite evolutionary distance. Determining whether Xenopus TRIM13 maintains this function would provide valuable evolutionary insights.

How do compensatory mechanisms affect TRIM13 knockout phenotypes?

The search results mention that innate immune cells from TRIM13 knockout mice may "have acquired compensatory circuits to retain relatively normal sensing of a pathogen-associated molecular pattern" . This raises important considerations for Xenopus studies:

  • Identification of potential compensatory mechanisms:

    • Perform transcriptomic analysis of TRIM13 knockout cells/animals

    • Identify upregulated genes that might compensate for TRIM13 loss

    • Focus on other TRIM family members that could have redundant functions

  • Double knockout approaches:

    • Generate combined knockouts of TRIM13 and potential compensatory genes

    • Assess whether more pronounced phenotypes emerge

    • Compare acute knockdown (e.g., siRNA) vs. stable knockout phenotypes

  • Temporal analysis:

    • Examine immediate vs. long-term consequences of TRIM13 depletion

    • Investigate whether compensatory mechanisms develop over time

Why might my recombinant Xenopus tropicalis TRIM13 be enzymatically inactive?

Several factors could contribute to enzymatic inactivity of recombinant TRIM13:

  • Structural issues:

    • Improper folding due to expression system limitations

    • Critical cysteine residues in the RING domain not properly coordinating zinc

    • Missing post-translational modifications required for activity

  • Experimental conditions:

    • Suboptimal buffer conditions for E3 ligase activity assays

    • Missing cofactors or interaction partners

    • Incorrect substrate proteins in ubiquitination assays

  • Domain integrity:

    • Ensure the RING domain is intact and properly folded

    • Fish studies showed the RING domain is essential for TRIM13 function

Troubleshooting E3 Ligase Activity
Issue
Improper folding
Missing cofactors
Buffer conditions
Substrate specificity

How can I improve the specificity of TRIM13 knockdown in Xenopus tropicalis?

Achieving specific knockdown can be challenging. Consider these approaches:

  • For morpholino-based knockdown:

    • Design morpholinos targeting translation start site or splice junctions

    • Include control morpholinos (standard control and mismatch controls)

    • Validate knockdown efficiency by Western blot or qRT-PCR

    • Perform rescue experiments with morpholino-resistant TRIM13 mRNA

  • For CRISPR/Cas9 genome editing:

    • Design multiple sgRNAs targeting different regions of the TRIM13 gene

    • Screen for off-target effects using prediction tools

    • Validate editing by sequencing and protein expression analysis

    • Generate homozygous lines through appropriate breeding strategies

  • Validation strategies:

    • Demonstrate consistent phenotypes with different knockdown approaches

    • Rescue phenotypes by expressing wild-type TRIM13

    • Show specificity by demonstrating other TRIM family members are unaffected

How can I reconcile contradictory results from in vitro versus in vivo TRIM13 studies?

To address such contradictions:

  • Consider cell type-specific effects:

    • TRIM13 function may be highly cell type dependent

    • Test multiple cell types and tissue contexts

  • Examine dose-dependent effects:

    • Overexpression may produce artifacts not relevant to physiological conditions

    • Use inducible or graduated expression systems

  • Investigate compensatory mechanisms:

    • Long-term knockout systems may develop compensatory pathways

    • Acute knockdown might reveal functions masked in stable knockouts

  • Contextual factors:

    • Consider the influence of specific viral challenges or immune stimuli

    • Examine temporal dynamics of responses

  • Cross-species validation:

    • Determine if the contradiction is species-specific

    • Compare with data from multiple model organisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.