Recombinant Xenopus tropicalis Tumor suppressor candidate 5 homolog (tusc5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
trarg1; tusc5; Trafficking regulator of GLUT4 1; Dispanin subfamily B member 1; DSPB1; Tumor suppressor candidate 5 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tusc5
Target Protein Sequence
MAINTDTQYEKALGGSGNPLPADSHETEKLLTNASENKEENGMKKSFSVTMSSEKSMGDL EQNGHNLPYKSVSAGQLESAPLSPSRVSLARASSTATTAQEQGRPTDYLVLAIFSCFCPV WPVNIVALVFSIMSRNSLQQGDLDGARRLGRLARLLSVVSILLGLVIIVLCILSLTIFH
Uniprot No.

Target Background

Function

This protein regulates insulin-mediated glucose uptake and transport in adipose tissue by modulating SLC2A4 recycling.

Database Links

KEGG: xtr:448489

UniGene: Str.5385

Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Endomembrane system; Single-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What methodological approaches can characterize TUSC5 expression patterns in Xenopus tropicalis?

To thoroughly characterize TUSC5 expression in Xenopus tropicalis, researchers should employ multiple complementary techniques:

  • Transcriptomic Analysis:

    • RNA-Seq on different tissues to quantify transcript abundance

    • Single-cell RNA-Seq to identify specific cell populations expressing TUSC5

    • Q-Exactive HF mass spectrometry with iTRAQ labeling for quantitative proteomics, similar to approaches used in spinal cord studies

  • Spatial Expression Analysis:

    • In situ hybridization on tissue sections or whole-mount preparations

    • Immunohistochemistry using validated antibodies against Xenopus tropicalis TUSC5

    • Reporter gene constructs driven by the TUSC5 promoter

  • Temporal Expression Studies:

    • Developmental time course analysis using RT-qPCR

    • Correlation with developmental stages using the Nieuwkoop and Faber (NF) staging system

    • Analysis during metamorphosis when tissue remodeling occurs

  • Environmental Response:

    • Cold exposure experiments to test if the cold-repression of TUSC5 observed in mammals is conserved in Xenopus

    • Response to PPARγ agonists like rosiglitazone or GW1929, which have been shown to increase TUSC5 expression in mammals up to 10-fold in pre-adipocytes and 1.5-fold in mature adipocytes

How can CRISPR-Cas9 be optimized for generating TUSC5 knockout Xenopus tropicalis models?

Creating TUSC5 knockout models in Xenopus tropicalis requires careful optimization of CRISPR-Cas9 methodology for this specific gene target:

  • Guide RNA Design:

    • Design sgRNAs targeting conserved functional domains, particularly the CD225 domain characteristic of TUSC5

    • Target early exons to maximize disruption of protein function

    • Use Xenopus-specific CRISPR design tools that account for genomic features of X. tropicalis

    • Test multiple guide RNA candidates for efficiency

  • Delivery Methods:

    • Microinjection into fertilized eggs at one-cell stage (standard method)

    • Optimize Cas9 and sgRNA concentrations to balance efficiency and toxicity

    • Consider using Cas9 protein rather than mRNA for more immediate activity

  • Mutation Verification:

    • Develop high-resolution melt analysis (HRMA) protocols specific to TUSC5 locus

    • Design primers for T7 endonuclease assays to detect indels

    • Sequence the target region to confirm mutations

    • Develop quantitative PCR assays to assess expression levels

  • Phenotype Analysis:

    • Examine metabolic parameters such as glucose tolerance and insulin sensitivity

    • Analyze adipose tissue development and neural development

    • Compare to mammalian TUSC5 knockout phenotypes, which show impaired glucose disposal

    • Test the effect of PPARγ agonists like rosiglitazone, which have reduced anti-diabetic effects in TUSC5 knockout mice

  • Breeding Strategy:

    • Raise F0 mosaic animals to adulthood

    • Screen F1 offspring for germline transmission of mutations

    • Establish homozygous lines for consistent experimental subjects

The development of TUSC5 knockout Xenopus models would provide valuable tools for comparative metabolic studies across vertebrate species.

What strategies can detect molecular interactions between TUSC5 and vesicle trafficking machinery in Xenopus tropicalis?

Understanding TUSC5's role in vesicle trafficking requires sophisticated approaches to detect protein-protein interactions in the Xenopus system:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged TUSC5 in Xenopus cells or tissues

    • Perform pull-down experiments followed by mass spectrometry

    • Compare interactome data with known mammalian TUSC5 interaction partners like GLUT4

    • Conduct differential interactome analysis under basal vs. insulin-stimulated conditions

  • Proximity Labeling Techniques:

    • Develop BioID or APEX2 fusion constructs with Xenopus TUSC5

    • Express in relevant cell types or transgenic animals

    • Identify proximal proteins through streptavidin purification and MS analysis

    • Compare proximity maps under different physiological conditions

  • Fluorescence Microscopy Approaches:

    • Create fluorescent protein fusions with TUSC5 and candidate partners

    • Perform live-cell imaging to track vesicle dynamics

    • Implement FRET or BRET systems to detect direct interactions

    • Use super-resolution microscopy to resolve vesicular structures

  • Biochemical Vesicle Analysis:

    • Isolate vesicle fractions from Xenopus tissues

    • Characterize TUSC5-containing vesicles by immunoblotting

    • Compare vesicle composition between wild-type and TUSC5-deficient samples

    • Analyze changes in vesicle populations in response to stimuli

  • Xenopus Oocyte Expression System:

    • Co-express TUSC5 and trafficking proteins in Xenopus oocytes

    • Perform electrophysiology or trafficking assays

    • Use this established Xenopus system to assess functional interactions

These approaches can help determine whether TUSC5's role in GLUT4 recycling and vesicle formation observed in mammals is conserved in Xenopus tropicalis.

How can STRING analysis be applied to understand TUSC5 interaction networks across species?

STRING (Search Tool for the Retrieval of Interacting Genes/Proteins) analysis can provide valuable insights into TUSC5 interaction networks, though special considerations are needed for Xenopus tropicalis:

  • Database Selection and Ortholog Mapping:

    • As the STRING database has limited data for Xenopus tropicalis, using human orthologs is often necessary for comprehensive analysis

    • Export Xenopus tropicalis TUSC5 gene symbols to find human orthologs

    • Generate STRING networks using default settings

    • Export XML files with interaction data for further processing in Cytoscape

  • Comparative Network Analysis:

    • Compare TUSC5 interaction networks between human, mouse, and available Xenopus data

    • Identify conserved interaction partners across species

    • Flag species-specific interactions for further investigation

    • Use Cytoscape to visualize and analyze network differences

  • Functional Enrichment Analysis:

    • Perform GO enrichment analysis on TUSC5 interaction networks

    • Compare enriched terms between proteomics and transcriptomics data

    • Filter for level 5 GO terms for more specific biological insights

    • Generate Venn diagrams to identify shared and unique GO terms

  • Integration with Experimental Data:

    • Overlay differential expression data onto interaction networks

    • Correlate network position with functional importance

    • Prioritize hub proteins for experimental validation

    • Compare with previously published interactome data for GLUT4 trafficking machinery

  • Experimental Validation Approaches:

    • Select high-confidence interactions for biochemical validation

    • Design co-immunoprecipitation experiments for key partners

    • Create reporter constructs to test functional relationships

    • Develop genetic interaction assays in Xenopus tropicalis

The STRING analysis of TUSC5 can guide experimental design and reveal potential conserved mechanisms in vesicle trafficking and metabolic regulation across vertebrate species.

What protocols are optimal for purifying recombinant Xenopus tropicalis TUSC5 for functional studies?

Purification of recombinant Xenopus tropicalis TUSC5 requires careful optimization to maintain protein integrity and function:

  • Expression System Selection:

    • E. coli has been successfully used for Xenopus tropicalis TUSC5 expression

    • BL21(DE3) or Rosetta strains are recommended for higher expression

    • Consider testing multiple strains to optimize yield and solubility

    • For studies requiring post-translational modifications, consider insect or mammalian expression systems

  • Purification Strategy:

    • For His-tagged TUSC5, use immobilized metal affinity chromatography (IMAC)

    • Optimize buffer conditions: start with Tris/PBS-based buffer, pH 8.0

    • Include protease inhibitors throughout purification process

    • Consider additional purification steps for higher purity:

      • Ion exchange chromatography

      • Size exclusion chromatography

  • Protein Stabilization:

    • Add stabilizing agents like trehalose (6%) to storage buffer

    • For long-term storage, add glycerol (5-50%) after reconstitution

    • Aliquot protein to avoid repeated freeze-thaw cycles

    • Store at -20°C or -80°C for extended periods

  • Quality Control Measures:

    • Verify purity by SDS-PAGE (>90% purity is achievable)

    • Confirm identity by mass spectrometry or western blotting

    • Test activity using appropriate functional assays

    • Check for proper folding using circular dichroism

  • Reconstitution Protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Allow complete dissolution before experimental use

    • For membrane protein studies, consider reconstitution into liposomes

This approach will provide high-quality recombinant TUSC5 protein suitable for structural studies, antibody production, and functional assays.

How can quantitative proteomics approaches be adapted to study TUSC5-dependent changes in Xenopus tropicalis?

Quantitative proteomics offers powerful insights into TUSC5-dependent changes in protein expression and modification:

  • iTRAQ Labeling Strategy:

    • Design an 8-plex iTRAQ experiment comparing:

      • Wild-type vs. TUSC5-knockout tissues

      • Basal vs. insulin-stimulated conditions

      • Different developmental stages

    • Pool peptides after labeling and separate by strong cation exchange liquid chromatography

    • Analyze using RPLC-ESI-MS/MS with a Q-Exactive HF mass spectrometer, similar to approaches used in Xenopus spinal cord studies

  • Sample Preparation Optimization:

    • For adipose tissue: develop specialized lipid removal procedures

    • For membrane proteins: optimize detergent extraction protocols

    • Create pools of biological replicates (3-5 animals per sample) to account for individual variation

    • Include uninjured/untreated samples as references

  • Data Analysis Pipeline:

    • Use MaxQuant for protein identification and quantification

    • Create a reference database based on the X. tropicalis genome v7.1

    • Set appropriate parameters for post-translational modification detection

    • Apply statistical methods to identify significantly changed proteins

  • Integration with Other Datasets:

    • Compare proteomic changes with transcriptomic data

    • Generate Venn diagrams to identify overlaps between datasets

    • Perform GO enrichment analysis on differentially expressed proteins

    • Create heatmaps and conduct hierarchical clustering to visualize patterns

  • Validation Experiments:

    • Select candidates for validation by western blotting

    • Perform immunohistochemistry to confirm spatial changes

    • Use targeted proteomics (MRM/PRM) for validation of specific proteins

    • Correlate proteomic changes with functional outcomes

This comprehensive proteomics approach will provide insights into the molecular mechanisms underlying TUSC5 function in Xenopus tropicalis.

What experimental design is recommended to evaluate TUSC5's role in PPARγ-mediated metabolic regulation in Xenopus tropicalis?

Investigating TUSC5's role in PPARγ-mediated metabolic regulation requires a multi-faceted experimental design:

  • Expression Correlation Studies:

    • Analyze TUSC5 expression in response to PPARγ agonists like rosiglitazone or GW1929

    • Compare response in different tissues (adipose, muscle, liver)

    • Measure time-course of expression changes

    • Determine if the 10-fold increase in pre-adipocytes and 1.5-fold increase in mature adipocytes observed in mammals is conserved in Xenopus

  • Promoter Analysis:

    • Identify potential PPAR response elements (PPREs) in the Xenopus tropicalis TUSC5 promoter

    • Create reporter constructs with wild-type and mutated PPREs

    • Perform chromatin immunoprecipitation (ChIP) to confirm PPARγ binding

    • Compare promoter architecture with mammalian TUSC5 genes

  • Functional Studies:

    • Generate TUSC5 knockout Xenopus tropicalis

    • Administer PPARγ agonists to wild-type and TUSC5 knockout animals

    • Measure glucose tolerance, insulin sensitivity, and adipocyte differentiation

    • Determine if the blunted anti-diabetic effects of TZDs observed in TUSC5 knockout mice are conserved in Xenopus

  • Molecular Pathway Analysis:

    • Perform RNA-Seq on wild-type and TUSC5-deficient tissues with/without PPARγ agonist treatment

    • Identify PPARγ-dependent genes affected by TUSC5 status

    • Map signaling pathways connecting PPARγ, TUSC5, and metabolic outcomes

    • Compare with mammalian pathways to identify conserved mechanisms

  • Translational Relevance:

    • Correlate TUSC5 expression levels with glucose tolerance in Xenopus

    • Determine if TUSC5 expression is predictive of metabolic health

    • Compare findings with human studies showing TUSC5 expression is predictive of glucose tolerance in obese individuals independent of body weight

This experimental design will elucidate whether TUSC5's role as a PPARγ target involved in metabolic regulation is conserved between mammals and amphibians.

How conserved is TUSC5 structure and function between Xenopus tropicalis and other model organisms?

Comparative analysis of TUSC5 across species provides insights into evolutionary conservation and functional significance:

  • Sequence Conservation:

    • Xenopus tropicalis TUSC5 (179 amino acids) contains the CD225 domain characteristic of this protein family

    • Perform multiple sequence alignment between Xenopus, human, mouse, and other vertebrate TUSC5 proteins

    • Identify highly conserved regions likely crucial for function

    • Map conservation onto predicted structural domains

  • Expression Pattern Comparison:

    • In mammals, TUSC5 shows robust expression in:

      • White adipose tissue (WAT)

      • Brown adipose tissue (BAT)

      • Peripheral nerves (primary somatosensory neurons)

    • Determine if this tissue-specific expression pattern is conserved in Xenopus tropicalis

    • Compare developmental timing of expression across species

  • Functional Conservation:

    • In mammals, TUSC5:

      • Controls insulin-stimulated glucose uptake in adipocytes

      • Facilitates GLUT4 recycling during prolonged insulin stimulation

      • Is regulated by PPARγ and repressed by cold exposure

    • Test these functions in Xenopus tropicalis through:

      • Glucose uptake assays

      • GLUT4 trafficking studies

      • Response to temperature changes and PPARγ agonists

  • Regulatory Mechanism Conservation:

    • Compare promoter elements between species

    • Analyze conservation of post-translational modifications

    • Determine if interacting partners are conserved

    • Test cross-species functional complementation:

      • Can mammalian TUSC5 rescue Xenopus TUSC5 knockout phenotypes?

      • Can Xenopus TUSC5 function in mammalian cell systems?

The high degree of synteny between Xenopus tropicalis and mammalian genomes suggests potential conservation of TUSC5 function, making this comparative approach particularly valuable .

What advantages does Xenopus tropicalis provide as a model for studying TUSC5 compared to Xenopus laevis?

Xenopus tropicalis offers several significant advantages over Xenopus laevis for TUSC5 research:

  • Genomic Simplicity:

    • Diploid genome (unlike the allotetraploid X. laevis)

    • Single TUSC5 gene rather than potentially duplicated copies in X. laevis

    • More straightforward gene editing and functional analysis

    • Less complicated interpretation of gene expression data

    • Closer conservation of gene structure with mammalian species

  • Genetic Manipulation Efficiency:

    • Smaller genome size facilitates more efficient targeted mutagenesis

    • Higher success rates with CRISPR-Cas9 and other gene editing approaches

    • Faster generation time (4-6 months to sexual maturity vs. 12-18 months for X. laevis)

    • More manageable husbandry requirements due to smaller adult size

  • Comparative Genomics Advantages:

    • Complete genome sequence available (Xtropicalis_v9.1 GCF_000004195.3)

    • Remarkable degree of synteny with mammalian genomes

    • Conserved gene organization over stretches of a hundred genes or more

    • Better model for comparative studies with human TUSC5

  • Evolutionary Position:

    • As the only known diploid species in the Xenopus genus

    • Represents ancestral gene organization before genome duplication events

    • Provides insights into evolution of TUSC5 function across vertebrates

    • More appropriate for tracing evolutionary conservation of TUSC5 function

  • Practical Considerations:

    • More manageable housing requirements

    • Reduced costs for maintenance and experiments

    • Ability to generate larger numbers of genetically modified animals

    • Comprehensive genetic and genomic resources specifically developed for X. tropicalis

These advantages make Xenopus tropicalis the preferred amphibian model for detailed genetic and functional studies of TUSC5.

How might studying TUSC5 in Xenopus tropicalis advance our understanding of metabolic disease pathways?

TUSC5 research in Xenopus tropicalis has significant potential to advance metabolic disease understanding through several innovative approaches:

  • Evolutionary Insights into Metabolic Regulation:

    • TUSC5's role in connecting adipose tissue function and nervous system signals represents a potentially ancient regulatory mechanism

    • Comparing TUSC5 function across vertebrates can reveal core metabolic regulatory pathways

    • Understanding conserved vs. species-specific aspects of glucose regulation provides evolutionary context

    • Identification of fundamental pathways that have been conserved across 350 million years of evolution

  • Novel Therapeutic Target Validation:

    • TUSC5's importance in PPARγ-mediated insulin sensitization suggests therapeutic potential

    • Xenopus offers a whole-organism system to test TUSC5-targeting compounds

    • Higher throughput than mammalian models for initial compound screening

    • Ability to assess tissue-specific and systemic effects simultaneously

  • Developmental Origins of Metabolic Disease:

    • Study how early developmental events influence TUSC5 expression and function

    • Examine epigenetic programming of TUSC5 during development

    • Leverage Xenopus's well-characterized developmental stages to track metabolic programming

    • Investigate how environmental factors during development affect TUSC5 expression and metabolism

  • Environmental Adaptation Mechanisms:

    • TUSC5's cold-responsiveness suggests involvement in environmental adaptation

    • Xenopus as a poikilotherm provides unique insights into temperature-dependent regulation

    • Study how TUSC5 coordinates metabolic responses to environmental changes

    • Potential applications for understanding climate change impacts on metabolism

  • Adipose-Nervous System Communication:

    • TUSC5's expression in both adipose tissue and peripheral nerves suggests a role in tissue communication

    • Xenopus models can help elucidate this adipose-nerve signaling axis

    • Potential relevance to metabolic disease-related neuropathies

    • New paradigm for understanding how environmental cues and CNS signals influence WAT-BAT physiology

These research directions could significantly advance our understanding of metabolic regulation and provide new avenues for therapeutic intervention in metabolic diseases.

What methodological challenges must be overcome to establish Xenopus tropicalis as a model for TUSC5-related metabolic research?

Establishing Xenopus tropicalis as a robust model for TUSC5-related metabolic research requires addressing several methodological challenges:

  • Metabolic Phenotyping Adaptation:

    • Develop standardized protocols for glucose tolerance testing in aquatic amphibians

    • Establish normal metabolic parameters for Xenopus tropicalis at different developmental stages

    • Create methods to measure insulin sensitivity appropriate for amphibian physiology

    • Adapt techniques for measuring adipose tissue function to the anatomical differences

  • Tissue-Specific Genetic Manipulation:

    • Develop adipose-specific promoters for transgenic expression

    • Create inducible systems for temporal control of TUSC5 expression

    • Optimize tissue-specific CRISPR delivery methods

    • Establish reliable methods for adipose tissue transplantation

  • Advanced Imaging Adaptations:

    • Develop clearing protocols optimized for Xenopus adipose tissue

    • Adapt intravital microscopy techniques for visualizing GLUT4 trafficking in vivo

    • Create fluorescent reporter lines for TUSC5 and key trafficking proteins

    • Establish methods for long-term imaging of metabolic processes

  • Physiological Monitoring Systems:

    • Design specialized equipment for measuring metabolism in aquatic organisms

    • Develop methods for continuous glucose monitoring in Xenopus

    • Create systems for measuring activity and energy expenditure

    • Adapt calorimetry approaches for amphibian metabolism

  • Translational Relevance Validation:

    • Establish clear correlations between Xenopus and mammalian metabolic pathways

    • Validate that TUSC5-dependent processes are conserved across species

    • Develop predictive models that connect Xenopus findings to human metabolism

    • Create standardized reporting frameworks for comparative metabolic studies

Addressing these methodological challenges will establish Xenopus tropicalis as a valuable complementary model system for metabolic research, offering unique advantages in developmental biology and genetic manipulation while maintaining translational relevance to human metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.