Recombinant Xenopus tropicalis Type-1 angiotensin II receptor-associated protein-like (agtrap)

What is the genomic structure of agtrap in Xenopus tropicalis?

The agtrap gene in Xenopus tropicalis consists of a single exon encoding a 163 amino acid protein. Unlike some other genes that contain multiple exons, the single-exon structure of agtrap simplifies genomic analysis and experimental manipulation. The gene shows strong synteny with those of amniotes, making it a valuable model for comparative genomic studies . The protein sequence (Q5EBF8) encodes a full-length polypeptide with distinct domains that contribute to its receptor-associated function. When designing experiments targeting agtrap, researchers should consider this simplified genomic structure for more efficient genetic manipulation.

Why use Xenopus tropicalis as a model for agtrap studies instead of Xenopus laevis?

Xenopus tropicalis offers distinct advantages over Xenopus laevis for agtrap studies, primarily due to its diploid genome (unlike the tetraploid X. laevis derived from hybridization of two separate species) . The diploid nature simplifies genetic analysis and manipulation, particularly when working with specific genes like agtrap. Additionally, X. tropicalis has a much shorter generation time (4-6 months compared to 1-2 years for X. laevis) and a smaller genome size (~1.5×10^9 bp, similar to zebrafish) . These characteristics facilitate genetic studies, including transgenic approaches and genome editing. Furthermore, X. tropicalis embryos develop at similar rates to X. laevis according to the developmental staging system of Nieuwkoop and Faber, allowing researchers to transfer techniques and knowledge between species .

What are the known structural features of recombinant Xenopus tropicalis agtrap protein?

The full-length Xenopus tropicalis agtrap protein consists of 163 amino acids with a sequence of: MELPAVNLKAIVFTHWLLTVFACMIDWLPKAYGLANITILAMGVWAIAQRDSIDAIFMFLIGLLLTILTDILLFALYFTEAEKASESGPLRDLFRFSSGMGIFSLLLKPLSCFFMYHMYRERGGEYFVNLGFITLSRDRSSYQSIEHMDPPADQDNKLPSRTY . Structural analysis indicates it contains transmembrane domains characteristic of receptor-associated proteins. When expressed recombinantly with an N-terminal His tag in E. coli, the protein maintains its functional domains. Researchers should note that the protein's structure includes hydrophobic regions that may affect solubility during experimental procedures. For optimal results in structural studies, consider using solutions containing mild detergents to maintain protein conformation while preventing aggregation.

What are the optimal conditions for reconstitution and storage of recombinant Xenopus tropicalis agtrap?

For optimal reconstitution of lyophilized recombinant Xenopus tropicalis agtrap protein, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Prior to opening, the vial should be briefly centrifuged to ensure all contents are at the bottom. For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being recommended) and aliquot to avoid repeated freeze-thaw cycles . Store aliquots at -20°C/-80°C for long-term storage, but working aliquots can be maintained at 4°C for up to one week . The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability . Researchers should avoid repeated freeze-thaw cycles as this can significantly reduce protein activity.

How can I validate the functionality of recombinant Xenopus tropicalis agtrap in experimental systems?

Validating recombinant Xenopus tropicalis agtrap functionality requires multiple complementary approaches. Begin with SDS-PAGE analysis to confirm protein purity (should be >90%) , followed by Western blotting using antibodies against either the His-tag or agtrap itself. For functional validation, co-immunoprecipitation assays with the angiotensin II type-1 receptor can confirm binding capacity. In Xenopus tropicalis systems, microinjection of the recombinant protein or corresponding mRNA into early embryos, followed by analysis of downstream signaling pathways, provides physiological validation. Researchers can leverage established Xenopus techniques such as morpholino knockdown of endogenous agtrap combined with rescue experiments using the recombinant protein to demonstrate functionality . Additionally, FRET-based interaction assays or surface plasmon resonance can quantitatively assess binding kinetics between agtrap and its interaction partners.

What are the recommended protocols for using recombinant agtrap in Xenopus tropicalis embryo experiments?

When designing experiments using recombinant agtrap in Xenopus tropicalis embryos, researchers should follow a systematic approach. For microinjection studies, dilute the reconstituted protein to 10-100 ng/μL in an appropriate injection buffer (typically 0.1× MMR with 5% Ficoll) and inject 2-5 nL into embryos at the one or two-cell stage. For older embryos, targeted injections can be performed at the 8-16 cell stage. Alternatively, mRNA encoding agtrap can be synthesized and injected at 50-500 pg per embryo. When performing loss-of-function studies, design morpholino oligonucleotides targeting the translation start site of endogenous agtrap, then test rescue with recombinant protein or mRNA encoding a morpholino-resistant construct . For all embryo manipulations, adhere to the developmental staging system of Nieuwkoop and Faber to ensure consistent experimental design. Monitor phenotypes through in situ hybridization for molecular markers and immunohistochemistry to detect changes in protein expression patterns.

How can CRISPR-Cas9 genome editing be used to study agtrap function in Xenopus tropicalis?

CRISPR-Cas9 genome editing offers powerful approaches for studying agtrap function in Xenopus tropicalis. To implement this technique, design sgRNAs targeting the single exon of the agtrap gene, focusing on the first fifth of the coding sequence for maximum disruption potential . When designing sgRNAs, use algorithms like inDelphi to predict repair outcomes, as these have shown high correlation with experimental results in X. tropicalis (Pearson r = 0.9886, p<0.0001) . For execution, inject a mixture of Cas9 recombinant protein (500-1000 pg) and sgRNA (200-400 pg) into fertilized eggs at the one-cell stage. To analyze editing efficiency, lyse stage NF 41 embryos and perform amplicon deep sequencing of the targeted region . Founder animals can be raised to adulthood and outcrossed to establish F1 heterozygous lines, which can then be incrossed to generate homozygous mutants. This approach allows for complete knockout of agtrap function, enabling comprehensive phenotypic analysis across development and into adulthood.

What strategies can be employed to investigate agtrap protein-protein interactions in Xenopus tropicalis systems?

Investigating agtrap protein-protein interactions in Xenopus tropicalis systems requires multilayered approaches. A primary strategy involves co-immunoprecipitation using anti-His antibodies to pull down His-tagged recombinant agtrap along with its binding partners from embryo or tissue lysates, followed by mass spectrometry identification . For in vivo validation, implement bimolecular fluorescence complementation (BiFC) by creating fusion constructs of agtrap with the N-terminal half of a fluorescent protein and potential interaction partners with the C-terminal half, then inject corresponding mRNAs into embryos to visualize interaction sites. Proximity ligation assays (PLA) offer another powerful approach for detecting protein-protein interactions with spatial resolution in tissue sections. For quantitative binding kinetics, express and purify recombinant agtrap and candidate partners for in vitro assays using surface plasmon resonance or isothermal titration calorimetry. The Xenopus oocyte system is particularly valuable for electrophysiological studies if agtrap interactions affect ion channel function. Finally, CRISPR-Cas9 editing can create specific mutations in functional domains to determine their importance for protein-protein interactions .

How can recombinant agtrap be used in comparative studies across different Xenopus species?

Comparative studies of agtrap across Xenopus species provide insights into evolutionary conservation and functional adaptation. When designing such studies, first establish sequence homology through bioinformatic analysis of agtrap in X. tropicalis, X. laevis, and other amphibian species. The diploid genome of X. tropicalis serves as a valuable reference point compared to the tetraploid genome of X. laevis, which may contain duplicate copies with potential subfunctionalization . For functional comparisons, perform parallel experiments using recombinant agtrap proteins from different species in standardized assays such as receptor binding or signaling pathway activation. In embryological studies, test cross-species rescue experiments by injecting X. tropicalis recombinant agtrap or mRNA into X. laevis embryos following knockdown of endogenous agtrap, and vice versa. When interpreting results, consider the developmental differences between species - while both develop according to the Nieuwkoop and Faber staging system, X. tropicalis has a faster development time and reaches sexual maturity earlier . These comparative approaches help determine which functional aspects of agtrap are evolutionarily conserved versus species-specific.

What are common challenges in expressing and purifying functional recombinant Xenopus tropicalis agtrap?

Researchers frequently encounter several challenges when expressing and purifying recombinant Xenopus tropicalis agtrap. The hydrophobic regions in agtrap's amino acid sequence (particularly in the transmembrane domains) can lead to protein aggregation and inclusion body formation during E. coli expression . To mitigate this, optimize expression conditions by using lower induction temperatures (16-18°C) and reduced IPTG concentrations (0.1-0.5 mM). For purification, incorporate mild detergents (0.1% DDM or 1% CHAPS) in lysis and purification buffers to maintain protein solubility. Another common issue is low yield; this can be addressed by using E. coli strains optimized for membrane protein expression (like C41(DE3) or C43(DE3)) and codon-optimizing the sequence for E. coli. Protein degradation during purification can be minimized by including protease inhibitor cocktails and maintaining samples at 4°C throughout processing. For quality assessment, combine SDS-PAGE analysis with functional assays to ensure that the purified protein retains its native conformation and binding capabilities.

How can I address inconsistent results when working with Xenopus tropicalis strain differences in agtrap studies?

Inconsistent results in agtrap studies can often be traced to genetic variation between Xenopus tropicalis strains. The three primary inbred strains (IC from Ivory Coast, N from Nigeria, and ICB) exhibit significant polymorphisms that can affect experimental outcomes . To address this variability, first identify and document the specific strain used in all experiments. The N strain is recommended for sequence-based interventions like morpholinos as the draft genome assembly is based on an inbred N animal . When comparing results across different studies, consider strain-specific allelic variations in agtrap and interacting genes. For critical experiments, perform parallel studies in multiple strains to identify strain-dependent effects. Alternatively, establish a consistent genetic background by backcrossing for at least 6-8 generations if creating transgenic lines. When designing morpholinos or CRISPR sgRNAs, check for strain-specific sequence variations in the target regions that might affect binding efficiency. Finally, create detailed data tables documenting strain-specific differences in agtrap expression, function, or response to experimental manipulations to establish a reference framework for the research community.

What control experiments are essential when studying agtrap function in Xenopus tropicalis developmental studies?

Robust control experiments are critical for validating findings in agtrap developmental studies. For morpholino-based knockdown, include a standard control morpholino injection group and a rescue group receiving both the agtrap-targeting morpholino and recombinant agtrap protein or mRNA encoding morpholino-resistant agtrap . In CRISPR-Cas9 experiments, use non-targeting sgRNAs and perform off-target analysis through whole-genome or targeted sequencing . When overexpressing agtrap, include dose-response experiments with varying amounts of protein or mRNA to differentiate between physiological and non-physiological effects. For embryological studies, track multiple developmental stages to distinguish between primary effects and secondary consequences. Include tissue-specific markers through in situ hybridization to precisely define affected developmental processes. When analyzing phenotypes, blind scoring by multiple observers reduces bias. Finally, validate key findings across different experimental approaches - for example, confirm CRISPR knockout results with morpholino knockdown or dominant-negative constructs. These comprehensive controls ensure that observed phenotypes are specifically attributable to alterations in agtrap function rather than experimental artifacts.

How does agtrap function compare between Xenopus tropicalis and mammalian models?

Comparative analysis reveals both conserved and divergent aspects of agtrap function between Xenopus tropicalis and mammalian models. The core function of agtrap as a regulator of angiotensin II signaling appears conserved, but important differences exist in tissue-specific expression patterns and developmental roles. The 163-amino acid Xenopus tropicalis agtrap shows approximately 65-70% sequence homology with mammalian counterparts, with highest conservation in the transmembrane domains and interaction interfaces . In both systems, agtrap negatively regulates angiotensin II type 1 receptor (AT1R) signaling, but the downstream effects may differ due to variations in the renin-angiotensin system across species. While mammalian studies emphasize agtrap's role in cardiovascular and renal physiology, Xenopus research has uncovered additional functions in early development and organogenesis. When designing translational studies, researchers should consider these functional differences and validate findings across models. The simplified genetic background of X. tropicalis (diploid versus tetraploid in X. laevis) offers advantages for mechanistic studies that can complement mammalian models . The table below summarizes key comparisons between Xenopus tropicalis and mammalian agtrap characteristics:

What bioinformatic tools are most effective for analyzing agtrap sequence, structure, and function across species?

For comprehensive bioinformatic analysis of agtrap, researchers should employ a multi-tiered approach combining sequence, structural, and functional prediction tools. Begin sequence analysis with multiple sequence alignment tools (MUSCLE, CLUSTALW) to compare agtrap sequences across species, identifying conserved domains and species-specific variations. For evolutionary analysis, MEGA-X and PhyML can generate phylogenetic trees to visualize evolutionary relationships. Structural prediction is particularly challenging for membrane-associated proteins like agtrap; use specialized tools such as TMHMM or Phobius to predict transmembrane domains, I-TASSER or AlphaFold2 for 3D structure prediction, and PSIPRED for secondary structure elements. For functional annotation, employ InterProScan to identify functional domains and GO term enrichment analysis to compare functional categories across species. Protein-protein interaction networks can be predicted using STRING or BioGRID, integrating experimental data from multiple species. For genomic context analysis, utilize genome browsers (UCSC, Ensembl) to examine synteny and regulatory elements. When applying these tools to Xenopus tropicalis agtrap, pay particular attention to the specialized Xenopus genome resources including Xenbase, which integrates genomic, expression, and functional data specifically for Xenopus species . This integrated bioinformatic approach provides a foundation for experimental design and interpretation of functional studies.