Recombinant Xenopus tropicalis Uncharacterized protein C17orf62 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cybc1; eros; Cytochrome b-245 chaperone 1 homolog; Essential for reactive oxygen species protein; Eros
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Protein Sequence
MYMQVESRTGTLLHLKRNPSIRSWSLLVGISSVGLAAAYYSTDTWLWKLFYVAGCAFVAL QNLEDWEEAIFDKKSGKAILITYSLYKKLLTLCKGGQEQVVVLLKEIRDVNVEEERVRYF GSGYVIVLRFVTGISHPLTQSAVLGARSDVEAVAKELTKFLEFDLVGSRPQAVEESNDSE SDEALDTQ
Uniprot No.

Target Background

Function

Functions as a chaperone, essential for the stable expression of the CYBA and CYBB subunits within the cytochrome b-245 heterodimer.

Database Links

KEGG: xtr:780298

UniGene: Str.31510

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

Methodological Questions

  • What are the optimal storage and handling conditions for recombinant Xenopus tropicalis C17orf62 homolog protein?

Based on manufacturer recommendations, the following storage and handling conditions are optimal for maintaining the stability and activity of recombinant Xenopus tropicalis C17orf62 homolog protein:

Storage Conditions:

  • Store at -20°C or -80°C for long-term storage

  • For working solutions, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

Storage Buffer:

  • Typically provided in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Some preparations include 50% glycerol as a cryoprotectant

Handling Recommendations:

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • Work with aliquots rather than repeatedly accessing the stock solution

  • For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • After reconstitution, add glycerol to a final concentration of 5-50% for enhanced stability

Following these guidelines will help ensure experimental reproducibility and maintain the protein's structural integrity and functional properties.

  • How can I reconstitute lyophilized recombinant Xenopus tropicalis C17orf62 homolog protein for experiments?

Proper reconstitution of lyophilized protein is critical for experimental success. Follow this methodological approach:

  • Pre-reconstitution preparation:

    • Allow the lyophilized protein to equilibrate to room temperature before opening (15-20 minutes)

    • Briefly centrifuge the vial to ensure all material is at the bottom

    • Prepare sterile materials and work in a clean environment to avoid contamination

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • Gently rotate or swirl the vial to dissolve the protein completely

    • Avoid vigorous shaking or vortexing which can cause protein denaturation

    • Allow the solution to sit for 5-10 minutes for complete rehydration

  • Post-reconstitution processing:

    • Add glycerol to a final concentration of 5-50% (manufacturer's default is 50%)

    • Prepare small single-use aliquots to avoid repeated freeze-thaw cycles

    • Label aliquots with protein name, concentration, date, and buffer composition

    • Flash-freeze aliquots in liquid nitrogen before storing at -80°C for optimal stability

  • Quality verification:

    • Verify protein concentration using standard protein assay methods

    • If possible, perform SDS-PAGE to confirm integrity and purity

    • For functional proteins, a small-scale activity assay can verify proper folding

Following these methodological steps will help ensure the reconstituted protein maintains its structural integrity and functional properties.

  • How can CRISPR/Cas9 be used to study the function of C17orf62 homolog in Xenopus tropicalis?

CRISPR/Cas9 genome editing in Xenopus tropicalis offers a powerful approach to study C17orf62 homolog function through the following methodological framework:

  • gRNA design and preparation:

    • Design multiple guide RNAs targeting conserved exons of the C17orf62 homolog gene

    • Utilize Xenopus-specific design tools available through Xenbase (https://www.xenbase.org)[3]

    • Synthesize gRNAs using in vitro transcription methods

    • Validate gRNA efficiency using in vitro cleavage assays

  • Microinjection approaches:

    • Two primary strategies can be employed:
      a) F0 mosaic analysis: Inject ribonucleoprotein complexes (gRNA + Cas9 protein) into both cells at 2-cell stage for complete knockout
      b) Unilateral knockout: Inject one cell at 2-cell stage to create half-mutant embryos with internal controls

    • The unilateral approach provides a powerful within-animal control system unique to Xenopus

  • Phenotypic analysis:

    • Perform morphological assessment at various developmental stages

    • Utilize molecular techniques (in situ hybridization, immunostaining) to assess cellular phenotypes

    • Conduct behavioral assays at tadpole stage (by day 10) for functional assessment

  • Validation approaches:

    • Verify mutations by sequencing PCR products from targeted regions

    • Perform Western blotting to confirm protein loss/reduction

    • Rescue experiments by co-injecting wildtype mRNA resistant to gRNA targeting

This methodology has been successfully applied to study numerous disease-related genes in Xenopus tropicalis, including those associated with autism spectrum disorders, congenital anomalies, cancer, heart disease, and kidney disease .

  • What approaches can be used to identify potential functions of the uncharacterized C17orf62 homolog protein?

Elucidating the function of uncharacterized proteins like C17orf62 homolog requires a multi-faceted experimental approach:

  • Comparative sequence analysis:

    • Perform phylogenetic analysis across species to identify conserved domains

    • Identify human homolog functions (CYBC1/EROS) as starting hypotheses

    • Use structural prediction algorithms to identify potential functional domains

  • Expression pattern analysis:

    • Determine spatiotemporal expression during development using in situ hybridization

    • Analyze single-cell transcriptomic atlases to identify cell types expressing the gene

    • Compare expression patterns with genes of known function to identify potential pathways

  • Loss-of-function studies:

    • Generate CRISPR/Cas9 knockout models in Xenopus tropicalis

    • Use morpholinos for transient knockdown to assess developmental requirements

    • Perform phenotypic analysis at cellular, tissue, and organismal levels

  • Protein interaction studies:

    • Conduct immunoprecipitation followed by mass spectrometry to identify binding partners

    • Perform yeast two-hybrid screens with tissue-specific libraries

    • Use proximity labeling approaches (BioID, APEX) in tissue contexts of interest

  • Functional assays based on homolog hints:

    • Since human C17orf62 (CYBC1/EROS) functions in reactive oxygen species biology, assess:
      a) ROS production in normal vs. knockout/knockdown conditions
      b) Immune cell function if expressed in hematopoietic tissues
      c) Redox-sensitive signaling pathways

By systematically implementing these approaches, researchers can build a comprehensive understanding of the protein's function, even without prior characterization.

  • How can I verify the purity and integrity of recombinant Xenopus tropicalis C17orf62 homolog protein?

Verification of protein purity and integrity is essential for reliable experimental results. Follow these methodological approaches:

  • SDS-PAGE analysis:

    • Run the protein on an appropriate percentage gel (12-15% recommended for this 188aa protein)

    • Include protein standards for molecular weight estimation

    • Verify a single band at the expected molecular weight (~20-22 kDa plus tag size)

    • Commercial preparations typically achieve >90% purity as determined by SDS-PAGE

  • Western blot verification:

    • Use antibodies specific to the protein or the affinity tag

    • Confirm single band at expected molecular weight

    • Consider using both N-terminal and C-terminal antibodies if available to verify full-length integrity

  • Mass spectrometry analysis:

    • Peptide mass fingerprinting to confirm sequence identity

    • Intact mass analysis to verify full-length protein and post-translational modifications

    • This approach can identify any truncations or modifications not visible by SDS-PAGE

  • Dynamic light scattering (DLS):

    • Assess protein homogeneity and aggregation state

    • Determine hydrodynamic radius to confirm proper folding

    • Particularly important before structural or interaction studies

  • Functional verification (if applicable):

    • If function becomes known, activity assays provide the best measure of protein integrity

    • For binding partners identified through interaction studies, perform binding assays

Commercial preparations of this protein typically report purity of greater than 90% as determined by SDS-PAGE , providing a benchmark for laboratory-produced material.

Advanced Research Questions

  • What is known about using Xenopus tropicalis as a model for human genetic disorders?

Xenopus tropicalis has emerged as a powerful model system for studying human genetic disorders, with several key methodological advantages:

  • Genetic manipulation capabilities:

    • CRISPR/Cas9 techniques are well-established and highly efficient

    • Unilateral mutagenesis (targeting one cell at 2-cell stage) provides within-animal controls

    • High tolerance of injected ribonucleoprotein complexes allows efficient F0 generation analysis

    • Ability to target genetic perturbations to specific tissues without complex genetic methods

  • Disease modeling successes:

    • Successful modeling of solid tumors including desmoid tumors and retinoblastoma

    • Leukemia models using tumor suppressor gene disruption

    • Models for autism spectrum disorders through study of risk genes

    • Congenital anomalies, cancer, heart disease, and kidney disease models

  • Phenotypic advantages over other models:

    • Some phenotypes more closely resemble human conditions than rodent models

    • Example: Mutations in pax6 result in phenotypes very similar to human congenital aniridia, while mouse models show a different "small-eye" phenotype

    • Example: USH1C mutations recapitulate both eye and ear abnormalities seen in human Usher syndrome 1C, unlike rodent models

  • High-throughput screening capabilities:

    • Ability to rapidly generate thousands of mutant embryos for parallel analysis of multiple genes

    • Tadpoles absorb small molecules from culture medium, facilitating drug screening

    • Enables identification of phenotypic convergence among disease-related genes

These methodological advantages make Xenopus tropicalis particularly valuable for studying complex genetic disorders and identifying potential therapeutic targets.

  • How can Xenopus tropicalis be used for studying hematologic malignancies like leukemia?

Xenopus tropicalis offers a unique experimental platform for studying hematologic malignancies through the following methodological approaches:

  • Genetic modeling strategies:

    • Mosaic CRISPR/Cas9-mediated genome editing to disrupt tumor suppressor genes (TSGs)

    • Targeting multiple genes simultaneously using multiplexed CRISPR is highly efficient

    • Positive clonal selection of leukemic cells allows identification of driver and modifier mutations

    • Generation of tissue-specific knockouts by targeted injections based on developmental fate maps

  • Analysis approaches for leukemia models:

    • Histological evaluation similar to that used for solid tumors

    • Genotypic analysis of affected tissues to confirm mutations

    • Alternative strategies to overcome limitations in antibody availability for immunophenotyping

  • Experimental applications:

    • Identifying novel driver and modifier mutations through multiplexed genome editing

    • Testing candidate therapeutic agents through small molecule screening

    • Analysis of disease progression through sampling at different developmental stages

    • Cross-species integration with human leukemia genomic data

  • Advantages over other models:

    • Diploid genome compared to zebrafish (another aquatic model)

    • More advanced immune system features compared to teleosts

    • External development allowing easy manipulation and observation

    • High fecundity enabling large-scale screening approaches

Despite some limitations (such as lack of antibodies for immunophenotyping), Xenopus tropicalis represents a valuable complementary model system that expands the toolbox for studying hematologic malignancies and identifying novel therapeutic strategies .

  • What approaches can be used to overcome the lack of antibodies for protein detection in Xenopus tropicalis?

The limited availability of specific antibodies for Xenopus proteins presents a significant challenge, but several methodological approaches can overcome this limitation:

  • Epitope tagging strategies:

    • Create transgenic lines expressing tagged versions of proteins of interest

    • Common tags include FLAG, HA, V5, or GFP for which commercial antibodies are readily available

    • CRISPR/Cas9 knock-in approaches can tag endogenous loci

    • Verify tag functionality through rescue experiments with tagged constructs

  • Cross-species antibody utilization:

    • Test antibodies against conserved epitopes from mammalian homologs

    • Perform sequence analysis to identify highly conserved regions as potential epitopes

    • Create synthetic peptides based on conserved regions for antibody production

    • Validate specificity using knockout/knockdown samples as negative controls

  • Alternative detection methods:

    • RNA expression analysis as a proxy for protein expression:

      • In situ hybridization for spatial pattern

      • qRT-PCR for quantitative analysis

      • Single-cell RNA sequencing for cell-type specific expression

    • Mass spectrometry-based proteomics for protein identification and quantification

    • Functional assays to detect protein activity rather than the protein itself

  • Reporter systems:

    • Create transcriptional reporters using endogenous promoters

    • Use translational fusions with fluorescent proteins in transgenic lines

    • Implement proximity labeling approaches (BioID, APEX) to identify interaction networks

  • CRISPR/Cas9-based labeling:

    • Implement CRISPRa/CRISPRi systems to modulate gene expression with fluorescent readouts

    • Use Cas13-based RNA detection as an alternative to protein detection

These approaches provide viable alternatives to conventional antibody-based detection methods and can be particularly valuable for studying uncharacterized proteins like C17orf62 homolog in Xenopus tropicalis.

  • What are the advantages of using Xenopus tropicalis for high-throughput genetic screening?

Xenopus tropicalis offers several distinct methodological advantages for high-throughput genetic screening:

  • Biological characteristics enabling high-throughput approaches:

    • Large clutch sizes (4000+ embryos per mating)

    • External fertilization and development

    • Rapid development of organ systems (within 4 days for many systems)

    • Transparent embryos and tadpoles facilitating observation

    • Year-round breeding potential with hormone induction

  • Efficient genetic manipulation techniques:

    • Highly efficient CRISPR/Cas9 mutagenesis (~90-100% efficiency)

    • Ability to perform mosaic F0 analysis without breeding to homozygosity

    • Unilateral mutagenesis providing within-animal controls

    • Straightforward multiplexed gene targeting for pathway analysis

    • Ability to create thousands of mutant embryos in a single day

  • Cost-effectiveness compared to mammalian models:

    • Significantly lower maintenance costs than rodent facilities

    • Less housing space required (1/5 that of X. laevis)

    • Shorter generation time (1/3 that of X. laevis)

    • No need for surgical procedures for embryo access

  • Screening applications:

    • Parallelized analysis of multiple disease-risk genes

    • Drug screening using small molecule absorption from culture medium

    • Tissue-specific screens using targeted injections

    • Behavioral phenotyping at tadpole stage (10 days)

These advantages make Xenopus tropicalis particularly suitable for genetic screens that would be prohibitively expensive or time-consuming in mammalian models, while still providing results relevant to human disease due to the high conservation of gene synteny with humans .

  • How does the conservation between Xenopus tropicalis and human genomes impact the study of disease-related proteins?

The high degree of genome conservation between Xenopus tropicalis and humans provides significant advantages for studying disease-related proteins:

  • Genomic synteny and orthology:

    • X. tropicalis shows high conservation of gene synteny with the human genome

    • The diploid nature of X. tropicalis (unlike the tetraploid X. laevis) simplifies orthology relationships

    • Accurate ortholog identification is facilitated by tools in Xenbase (https://www.xenbase.org)[3]

    • This enables more reliable translation of findings to human disease mechanisms

  • Conservation of developmental and disease mechanisms:

    • Many developmental pathways and disease mechanisms are highly conserved

    • Example: Mutations in eye transcription factor pax6 produce phenotypes more similar to human aniridia than mouse models

    • Example: USH1C mutations recapitulate both eye and ear phenotypes seen in human Usher syndrome

  • Methodological advantages for disease modeling:

    • Conservation allows targeted disruption of specific disease-associated genes

    • High-throughput "phenotypic convergence" approaches can identify common mechanisms among disease-risk genes

    • Ability to perform comparative functional genomics across vertebrate species

  • Translational impact:

    • Identification of conserved gene function informs human disease mechanisms

    • Drug targets identified in X. tropicalis are more likely to be relevant in humans

    • Small molecule screens in X. tropicalis can be directly translated to human therapeutic development

Disease CategoryExamples Successfully Modeled in X. tropicalisReference
NeurodevelopmentalAutism spectrum disorders
CongenitalAniridia, Usher syndrome
CancerDesmoid tumors, retinoblastoma, leukemia
CardiovascularCongenital heart disease
RenalKidney disease

This high degree of conservation makes X. tropicalis a particularly valuable model for understanding the function of uncharacterized proteins like C17orf62 homolog in the context of human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.