Recombinant Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

The UPF0444 transmembrane protein C12orf23 homolog belongs to a protein family designated as UPF0444, where "UPF" stands for uncharacterized protein family. This designation indicates that while the protein has been identified and sequenced, its precise functional characteristics remain to be fully elucidated. The protein is homologous to a human protein encoded by an open reading frame on chromosome 12 (C12orf23) . In Xenopus tropicalis, this protein is encoded by the tmem263 gene, with the alternative name "Transmembrane protein 263," highlighting its membrane-spanning properties .

Expression Systems and Purification

The recombinant form of this protein is typically produced in Escherichia coli expression systems. According to product specifications, the full-length protein (amino acids 1-114) is fused to an N-terminal histidine (His) tag, which facilitates purification and detection in downstream applications . After expression in E. coli, the protein undergoes purification processes to achieve high purity levels, typically greater than 90% as determined by SDS-PAGE analysis .

Evolutionarily Conserved Homologs

The UPF0444 transmembrane protein C12orf23 has homologs in various vertebrate species, suggesting evolutionary conservation and potential biological significance. Several mammalian homologs have been identified and characterized:

  1. Mouse (Mus musculus): The mouse homolog is known as transmembrane protein 263 (Tmem263), with synonyms including "UPF0444 transmembrane protein C12orf23 homolog." It has a molecular mass of approximately 11.5 kDa and shows ubiquitous expression across multiple tissues, including placenta and limb during embryonic development .

  2. Bovine (Bos taurus): The bovine homolog is also called transmembrane protein 263 (TMEM263), with synonyms C12orf23 and C5H12orf23 .

  3. Human: The human homolog is encoded by the TMEM263 gene located on chromosome 12 .

The conservation of this protein across diverse vertebrate species, from amphibians to mammals, suggests it may play a fundamental biological role that has been maintained throughout vertebrate evolution.

Xenopus tropicalis as a Model Organism

Xenopus tropicalis has emerged as an important model organism in developmental biology, genetics, and genomics research. Unlike its relative Xenopus laevis, X. tropicalis offers several advantages, including a simpler diploid genome and shorter generation time, making it more suitable for genetic, genomic, and transgenic approaches .

The embryos of X. tropicalis closely resemble those of X. laevis, except for their smaller size, and experimental techniques developed for X. laevis can be readily adapted for X. tropicalis . This compatibility facilitates the transfer of knowledge and methodologies between these related model systems.

Functional Genomics and Protein Studies

The recombinant Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog serves as a valuable tool for various research applications:

  1. Antibody Production: The purified recombinant protein can be used to generate specific antibodies for detecting the endogenous protein in Xenopus tropicalis tissues, enabling protein localization studies and expression analysis.

  2. Protein-Protein Interaction Studies: The His-tagged recombinant protein facilitates investigations of protein-protein interactions through techniques such as pull-down assays, co-immunoprecipitation, or protein microarrays.

  3. Functional Assays: The recombinant protein can be employed in biochemical assays to investigate its potential enzymatic activities, binding properties, or cellular functions.

  4. Structural Biology: Purified protein samples are essential for structural determination methods, including X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy.

Developmental Biology and Genetic Research

Xenopus tropicalis has become increasingly important for developmental genetics and functional genomics research . Genomic manipulation techniques such as gynogenesis facilitate genetic screens by permitting the identification of recessive phenotypes after only one generation . Stable transgenic lines can be used both as in vivo reporters to streamline embryologic and molecular assays, or to experimentally manipulate gene expression through binary constructs like the GAL4/UAS system .

The availability of recombinant proteins like the UPF0444 transmembrane protein C12orf23 homolog supports these advanced genetic approaches by providing tools for protein function studies, antibody generation, and phenotype analysis.

Working with Recombinant Proteins

When designing experiments with the recombinant Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog, several technical considerations should be taken into account:

  1. Tag Interference: The N-terminal His-tag, while useful for purification, may potentially affect protein function or interaction in some experimental contexts. Control experiments may be necessary to assess any tag-related effects.

  2. Protein Solubility: As a transmembrane protein, solubility might be a challenge in aqueous buffers. The addition of appropriate detergents or membrane-mimetic systems may be necessary for certain applications.

  3. Post-Translational Modifications: When expressed in prokaryotic systems like E. coli, the recombinant protein may lack eukaryotic post-translational modifications that might be present in the native protein. This should be considered when interpreting experimental results.

  4. Protein Stability: Following the recommended storage and handling guidelines is crucial to maintain protein integrity throughout experimental procedures.

Experimental Applications Table

ApplicationTechniqueAdvantagesConsiderations
Antibody ProductionImmunization with purified proteinGenerates specific detection toolsAntibody specificity must be validated
Protein LocalizationImmunohistochemistry, ImmunofluorescenceReveals spatial distribution in tissuesRequires specific antibodies
Protein InteractionsPull-down assays, Co-IP, Y2HIdentifies binding partnersTag may interfere with some interactions
Structural StudiesX-ray crystallography, NMRProvides atomic-level structural informationRequires highly pure, homogeneous samples
Functional AssaysEnzymatic assays, Binding studiesCharacterizes biochemical activitiesMay require native conformation

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem263; Transmembrane protein 263
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem263
Target Protein Sequence
MSQTEKIEEAVPSYLCEEPPEGTVKDHPQQQPGMISRVTGGIFSMTKGAVGATIGGVAWI GGKSYEVTKTAVTSVPSIGVGIVKGSVSAVTGSVAAVGSVVSSKVSGKKKDKSD
Uniprot No.

Target Background

Database Links

KEGG: xtr:395036

UniGene: Str.6196

Protein Families
TMEM263 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0444 transmembrane protein C12orf23 homolog and why is it studied in Xenopus tropicalis?

The UPF0444 transmembrane protein C12orf23 homolog is a protein identified in Xenopus tropicalis (Western clawed frog) that shares homology with the human C12orf23 gene product. The "UPF0444" designation indicates it belongs to an uncharacterized protein family (UPF) with the specific identifier 0444. Xenopus tropicalis serves as an excellent model organism due to its diploid genome (unlike the tetraploid X. laevis), allowing for clearer genetic analysis while maintaining the experimental advantages of amphibian models. Studying this protein in X. tropicalis provides insights into its conserved functions across vertebrates and potentially illuminates its role in human biology and disease .

What is the amino acid sequence and structural characteristics of this protein?

The amino acid sequence of the Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog is: "MSQTEKIEEAVPSYLCEEPPEGTVKDHPQQQPGMISRVTGGIFSMTKGAVGATIGGVAWIGGKSYEVTKTAVTSVPSIGVGIVKGSVSAVTGSVAAVGSVVSSKVSGKKKDKSD" . This 114-amino acid protein (expression region 1-114) is characterized as a transmembrane protein, suggesting it contains hydrophobic domains that span cellular membranes. The protein is encoded by a full-length coding sequence and has been assigned the UniProt accession number Q6P1V1 .

How does this protein compare to its orthologs in other species?

The C12orf23 homolog represents a conserved protein family found across vertebrate species. Xenbase and other genomic resources indicate orthology relationships between this X. tropicalis protein and similar proteins in humans, mice, zebrafish, and other model organisms . The Xenopus ORFeome project has identified human orthologs for approximately 7,000 frog clones, with about 2,200 of these genes associated with human diseases . Comparative analysis of this protein across species can provide valuable insights into evolutionarily conserved functions and potential roles in developmental or cellular processes.

What are the optimal storage conditions for the recombinant protein?

The recombinant X. tropicalis UPF0444 transmembrane protein C12orf23 homolog should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein . For short-term storage, maintain working aliquots at 4°C for up to one week. For longer-term storage, keep the protein at -20°C, and for extended storage periods, conserve samples at -20°C or -80°C . It is crucial to avoid repeated freezing and thawing cycles as this can lead to protein degradation and loss of functional activity .

What expression systems are recommended for producing this recombinant protein?

While the search results don't specify the expression system used for this particular protein, the Xenopus ORFeome project utilizes Gateway cloning systems for recombinant protein expression . This system allows for efficient transfer of ORFs into diverse expression vectors through recombineering. For optimal expression of Xenopus proteins, researchers should consider expression in eukaryotic systems such as mammalian cell lines (e.g., HEK293), which may provide appropriate post-translational modifications. When designing expression experiments, researchers should account for the transmembrane nature of this protein, which may require specialized extraction and purification protocols .

How can researchers incorporate this protein into functional assays?

Incorporating this transmembrane protein into functional assays requires careful consideration of its native environment. For membrane proteins, researchers should consider reconstitution into liposomes or nanodiscs to maintain native conformation and function. For interaction studies, techniques such as co-immunoprecipitation, pull-down assays, or yeast two-hybrid systems may be employed, though modifications may be necessary for transmembrane proteins . The Xenopus model offers unique advantages for functional studies, including the ability to perform microinjection of mRNA encoding this protein into embryos, followed by phenotypic analysis to assess developmental effects .

How can this protein be utilized in developmental biology research?

The Xenopus tropicalis UPF0444 transmembrane protein can serve as a valuable tool in developmental biology research due to the distinctive advantages of the Xenopus model system. Researchers can microinject mRNA encoding this protein into embryos to study gain-of-function effects or use morpholinos to inhibit its expression for loss-of-function studies . The rapid development of Xenopus embryos allows for quick analysis of phenotypic effects, with a full set of differentiated tissues forming within days of fertilization . Additionally, whole-mount in situ hybridization can be performed to analyze the expression pattern of the corresponding gene during development, providing insights into potential developmental roles .

What approaches can be used to study protein-protein interactions involving this transmembrane protein?

To study protein-protein interactions involving the UPF0444 transmembrane protein, researchers can employ several complementary approaches. Yeast two-hybrid systems, co-immunoprecipitation, and pull-down assays represent standard methods for detecting direct protein interactions . For transmembrane proteins, split-ubiquitin membrane yeast two-hybrid systems may be more appropriate. Mass spectrometry-based approaches following cross-linking and immunoprecipitation can identify interaction partners in more complex biological contexts. Additionally, proximity labeling methods such as BioID or APEX can capture both stable and transient interactions in the native cellular environment, which is particularly valuable for membrane proteins that may form dynamic complexes at cellular interfaces.

How does the Gateway cloning system facilitate research with this protein?

The Gateway cloning system, utilized by the Xenopus ORFeome project, significantly enhances research flexibility when working with this protein . This recombineering-based system allows the ORF sequence to be easily transferred from entry vectors into diverse expression vectors, enabling rapid deployment in various experimental contexts . Researchers can quickly generate constructs for bacterial expression, mammalian cell expression, in vitro translation, or fusion with different tags (fluorescent proteins, epitope tags) without the need for traditional restriction enzyme cloning . This versatility accelerates functional characterization, localization studies, and protein interaction analyses, thereby streamlining the research workflow and enabling higher-throughput approaches to protein function analysis .

What structural analysis techniques are most appropriate for this transmembrane protein?

For structural analysis of the UPF0444 transmembrane protein, researchers should consider a multi-faceted approach. While X-ray crystallography has traditionally been challenging for membrane proteins, recent advances in cryo-electron microscopy (cryo-EM) provide opportunities to resolve structures in near-native conditions. Nuclear magnetic resonance (NMR) spectroscopy can provide valuable information about protein dynamics and interactions, particularly for smaller membrane proteins or specific domains. Computational methods including homology modeling and molecular dynamics simulations can complement experimental approaches, especially when leveraging known structures of related proteins. For initial characterization, circular dichroism spectroscopy can provide information about secondary structure content, while hydrogen-deuterium exchange mass spectrometry can reveal surface accessibility and conformational dynamics.

How can researchers distinguish between the functions of X. tropicalis C12orf23 homolog and its X. laevis paralog?

Distinguishing between the functions of the X. tropicalis C12orf23 homolog and its X. laevis paralog requires strategic experimental design that accounts for the tetraploid nature of X. laevis compared to the diploid X. tropicalis . Researchers should first perform sequence alignment and phylogenetic analysis to establish orthology relationships and identify potential functional divergence . Species-specific knockdown experiments using morpholinos designed to target either the tropicalis or laevis genes can reveal differential phenotypes . Cross-species rescue experiments, where the tropicalis gene is expressed in laevis embryos after knockdown of the laevis paralog (and vice versa), can assess functional conservation. Additionally, species-specific antibodies or epitope tagging can enable comparative localization studies, while RNA-seq analysis after gene manipulation can identify differential effects on downstream pathways.

What are the challenges and considerations when using recombinant versus native protein for functional studies?

When designing experiments with recombinant Xenopus tropicalis UPF0444 transmembrane protein, researchers must consider several key differences from the native protein. Recombinant proteins may lack authentic post-translational modifications, potentially affecting function, localization, or interaction dynamics. The tag used during production (which varies according to the production process for this protein) may interfere with protein folding or function, necessitating control experiments with differently tagged or untagged versions . The buffer conditions (Tris-based buffer with 50% glycerol) differ from the native cellular environment, potentially affecting protein conformation . Additionally, recombinant proteins lack the temporal and spatial regulation present in vivo, which may be critical for understanding developmental or context-dependent functions. Whenever possible, researchers should validate findings from recombinant protein studies with in vivo approaches, such as gene editing or knockdown in Xenopus embryos.

How should researchers approach contradictory results when studying this poorly characterized protein?

When encountering contradictory results while studying the UPF0444 transmembrane protein C12orf23 homolog, researchers should implement a systematic troubleshooting approach. First, thoroughly document experimental conditions, including protein preparation methods, buffer compositions, and assay parameters, as small variations may significantly impact outcomes for membrane proteins. Cross-validate findings using complementary methodologies; for instance, if protein interaction results differ between co-immunoprecipitation and yeast two-hybrid assays, consider alternative approaches like proximity labeling or split-fluorescent protein systems. Consult databases like Xenbase and UniProt for updates on protein annotation and functional characterization . Consider species-specific differences when comparing results between X. tropicalis and other models, as the tetraploid nature of X. laevis versus the diploid X. tropicalis can complicate interpretations . Finally, remember that as a member of an uncharacterized protein family (UPF0444), contradictions in the literature may reflect genuine complexity in protein function rather than experimental error.

What control experiments are essential when working with this recombinant protein?

When working with recombinant Xenopus tropicalis UPF0444 transmembrane protein, several control experiments are essential to ensure valid and reproducible results. Protein quality controls should include SDS-PAGE analysis to confirm size and purity, western blotting to verify identity, and circular dichroism to assess proper folding. For functional assays, researchers should include a tagged control protein (non-related but similarly produced) to distinguish specific effects from those caused by the tag or production method . Temperature stability tests are advisable given the storage recommendations (-20°C to -80°C with avoidance of freeze-thaw cycles) . When studying protein-protein interactions, both positive controls (known interactors) and negative controls (proteins unlikely to interact) should be included. For in vivo studies, rescue experiments following morpholino knockdown can confirm specificity, while dose-response experiments can distinguish physiological from artifactual effects .

How can researchers leverage Xenbase and other databases to enhance their experimental design and interpretation?

Researchers can strategically leverage Xenbase and complementary databases to optimize experimental design and interpretation when studying the UPF0444 transmembrane protein. Xenbase integrates diverse biological and genomic data from both Xenopus laevis and Xenopus tropicalis, allowing researchers to compare gene models, expression patterns, and functional annotations across species . Before designing experiments, researchers should thoroughly explore the protein's gene page on Xenbase to access JGI gene models, synteny information, GO terms, and orthology relationships with human, mouse, and zebrafish proteins . The UniProt entry (Q6P1V1) provides additional sequence features, predicted domains, and potential modifications . Researchers should cross-reference findings with human data through HGNC, as Xenopus gene nomenclature follows human conventions . For protein interactions, databases like STRING or BioGRID may contain relevant predictions based on orthology. Additionally, the Xenopus ORFeome project resources can provide validated clones for expression studies, accelerating experimental workflows .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.