Recombinant Xenopus tropicalis UPF0694 transmembrane protein C14orf109 homolog (TEgg078g21.1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus tropicalis UPF0694 Transmembrane Protein C14orf109 Homolog (TEgg078g21.1)

The compound "Recombinant Xenopus tropicalis UPF0694 transmembrane protein C14orf109 homolog (TEgg078g21.1)" refers to a protein derived from the frog species Xenopus tropicalis. This protein is a homolog of the human protein C14orf109, also known as transmembrane protein 251 (TMEM251) .

General Information

  • Nomenclature The protein is also known as UPF0694 transmembrane protein C14orf109 homolog (TEgg078g21.1) .

  • Source Organism The protein originates from Xenopus tropicalis, a frog species .

  • Human Homolog The Xenopus tropicalis protein is homologous to the human protein C14orf109, also known as transmembrane protein 251 (TMEM251) .

Gene Information (Human TMEM251)

The TMEM251 gene in humans provides insight into the potential characteristics of its Xenopus tropicalis homolog :

  • Location Located on chromosome 14 at 14q32.12 .

  • Size The gene spans 1,277 base pairs .

  • Introns/Exons Contains 3 introns. Transcription produces six different mRNAs that vary by truncation of the 3' end. There are 2 transcript variants that encode for the TMEM251 protein, with the longer one being 169 base pairs in length, and the shorter one being 131 base pairs in length .

  • Transcript Variants Two transcript variants encode the TMEM251 protein. The first transcript variant encodes a shorter predicted protein, while the second transcript variant encodes a protein with a longer N-terminus. Both consists of two exons that include the entire coding sequence for the TMEM251 protein .

Expression and Localization

  • Restricted Expression In Xenopus, studies using a Xenopus POMC gene promoter fragment showed melanotrope cell-specific expression of a transgene, with varying levels of expression depending on the background color of the animal .

  • Subcellular Localization Research indicates that the Xenopus p24δ 2 protein, related to protein transport, can be found in both the endoplasmic reticulum (ER) and Golgi regions within melanotrope cells .

Research Applications

  • Antibody Production The Xenopus tropicalis protein is used in the production of monoclonal antibodies for research purposes .

  • Transgenic Studies Xenopus is utilized to generate transgenic models for studying protein function and interactions within cells .

  • Functional Studies The protein is useful in studies related to the function and dynamics of proteins within the secretory pathway .

Related Research

The Xenopus system is employed in various studies, providing a context for understanding the broader research landscape :

  • BMP Antagonists Studies have investigated the effects of depleting BMP antagonists in Xenopus tropicalis, leading to significant developmental abnormalities .

  • GIRK5 Channels Research on G protein-activated inward-rectifying potassium (K+) channels (Kir3/GIRK) in Xenopus laevis oocytes has identified unique endoplasmic reticulum retention motifs .

  • p24 System Transgenic Xenopus models have been used to study the role of p24 proteins in the early secretory pathway, revealing their importance for efficient cargo transport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling your request.
Synonyms
tmem251; TEgg078g21.1; Transmembrane protein 251
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem251
Target Protein Sequence
MWRVEFVACLRPSCQFCTAMCSILSAGRAWRMMNFRQRMGWIGVSLYLFVSAAAFYYVFE INETYNRLALEHVQLKPQEPHRGTTWTHSLKARLLSLPFWLWAALFLIPYFQVFLFLYSC TRADPKTVGYCIIPICLAIICNRHQSFVKASNQISRLQLIDT
Uniprot No.

Target Background

Database Links

KEGG: xtr:497000

UniGene: Str.4165

Protein Families
TMEM251 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the significance of using Xenopus tropicalis as a model organism for studying UPF0694 transmembrane protein C14orf109 homolog?

    Xenopus tropicalis offers multiple methodological advantages for studying transmembrane proteins like C14orf109 homolog. The species features a diploid genome with high conservation between frogs and humans, exhibiting significant synteny that facilitates the identification of orthologous genes . This conservation is particularly valuable when investigating transmembrane proteins that may have conserved functions across species.

    Practically, the Xenbase database (https://www.xenbase.org) provides user-friendly access to an accurately annotated reference genome with excellent tools for genetic analysis and interpretation . Laboratory colonies of X. tropicalis are well-established and cost-effective compared to rodent models, with a single pair capable of producing over 4,000 embryos in a day through either natural mating or in vitro fertilization .

    For transmembrane protein studies, the rapid development of X. tropicalis embryos is particularly advantageous – by day 4, they have developed key organ systems including central and peripheral nervous systems, sensory organs, kidneys, skeletal muscle, and cardiovascular systems . This allows for efficient phenotypic analysis of transmembrane protein function across multiple tissue types.

  • How can genetic perturbation protocols be applied to study the function of UPF0694 transmembrane protein C14orf109 homolog in Xenopus tropicalis?

    Genetic perturbation of UPF0694 transmembrane protein C14orf109 homolog in X. tropicalis can be efficiently achieved through CRISPR/Cas9 mutagenesis, which is well-established and cost-effective in this model organism . The methodology offers a unique advantage in X. tropicalis: mutagenesis of one of the two cells at the 2-cell stage embryo yields a unilateral mutant, where one half of the animal carries a homozygous mutation while the other half serves as a within-animal control .

    The experimental protocol typically involves:

    1. Design of guide RNAs targeting the TEgg078g21.1 gene sequence

    2. Microinjection of CRISPR/Cas9 ribonucleoprotein complexes into one cell at the 2-cell stage

    3. Verification of mutation efficiency through DNA extraction and sequencing

    4. Phenotypic analysis comparing the mutant and wild-type sides of the same animal

    This approach enables truly parallelized analysis by generating thousands of mutant embryos per day, each with its own internal control . For transmembrane proteins like UPF0694 C14orf109 homolog, this methodology allows for efficient assessment of its role in membrane dynamics, cellular signaling, and tissue development.

  • What experimental design is most appropriate for studying phenotypic effects of UPF0694 transmembrane protein C14orf109 homolog mutation in Xenopus tropicalis?

    A time-series experimental design is particularly effective for studying phenotypic effects of UPF0694 transmembrane protein mutations in X. tropicalis. This design involves multiple observations both before and after the genetic perturbation, allowing researchers to track developmental changes with high temporal resolution .

    For optimal experimental design, consider the following approach:

    PhaseTimepointsMeasurementsAnalysis
    Pre-treatmentDays 1-4 post-fertilizationMorphology, RNA expression, protein localizationEstablish baseline development
    TreatmentDay 4CRISPR/Cas9 injection or morpholino knockdownTarget TEgg078g21.1 gene
    Post-treatmentDays 5-12 post-fertilizationMorphology, behavior, RNA expression, protein localizationAssess phenotypic consequences

    This design maximizes both internal and external validity through multiple pre-treatment measurements (establishing normal developmental trajectories) and post-treatment observations (capturing both immediate and long-term effects) . The inclusion of control groups (uninjected, control morpholino, or non-targeting CRISPR) is essential to distinguish treatment effects from normal developmental variation or technical artifacts .

    When analyzing results, look for consistent patterns across multiple independent experiments rather than relying on single observations, as developmental timing can vary slightly between batches of embryos .

Advanced Research Questions

  • What are the optimal methods for genetic code expansion to incorporate unnatural amino acids into UPF0694 transmembrane protein C14orf109 homolog in Xenopus?

    Genetic code expansion provides a sophisticated approach for incorporating unnatural amino acids (UAAs) into the UPF0694 transmembrane protein C14orf109 homolog, enabling detailed structure-function studies. While the methodology has been primarily optimized in Xenopus laevis, the principles can be adapted for X. tropicalis with appropriate modifications .

    The experimental protocol involves the following steps:

    1. Generate mRNA for the pyrrolysyl-tRNA synthetase (PylRS) and the protein of interest (UPF0694 transmembrane protein) with an amber stop codon (TAG) at the desired site for UAA incorporation.

    2. Clone the gene of interest into a pCS2 vector, which serves as a template for Sp6 in vitro transcription and includes a 3′ SV40 polyA signal .

    3. Use the mMessage mMachine in vitro Transcription Kit to generate 5′ capped mRNA.

    4. Transcribe the pyrrolysyl tRNA (PylT) using a PCR product as the template for T7 in vitro transcription.

    5. Prepare a mixture containing PylRS mRNA (250 pg), PylT (7.5 ng), UPF0694 transmembrane protein mRNA with amber mutation (250 pg), and the desired UAA .

    6. Inject this mixture into fertilized one-cell-stage Xenopus embryos in a total volume of 5 nl.

    For transmembrane proteins, incorporation efficiency varies depending on the specific UAA used. Lysine analogs typically show better incorporation when directly injected, while phenylalanine-based UAAs may be efficiently transported into cells after simple addition to the embryo water . The optimal UAA concentration ranges from 10-50 mM in the injection solution (at least 50 pmol total injected) .

    Verification of successful UAA incorporation can be achieved through:

    • Western blot analysis to confirm full-length protein expression

    • Mass spectrometry to verify UAA incorporation at the desired position

    • Functional assays to assess the impact of the UAA on protein activity

  • How can quasi-experimental designs be utilized to study the role of UPF0694 transmembrane protein C14orf109 homolog in complex developmental processes?

    Quasi-experimental designs offer methodological flexibility when studying the role of UPF0694 transmembrane protein C14orf109 homolog in complex developmental processes where complete randomization may not be possible. These designs are particularly valuable when investigating how this transmembrane protein functions across different developmental contexts or genetic backgrounds .

    A robust approach is the nonequivalent control group design with time-series observations:

    GroupPre-intervention measurementsInterventionPost-intervention measurements
    ExperimentalO₁ O₂ O₃ O₄X (C14orf109 homolog perturbation)O₅ O₆ O₇ O₈
    ControlO₁ O₂ O₃ O₄-O₅ O₆ O₇ O₈

    In this design, O represents observations at different developmental stages, and X represents the targeted perturbation of the UPF0694 transmembrane protein through morpholinos, CRISPR/Cas9, or overexpression . Multiple pre-intervention measurements establish baseline developmental trajectories, while post-intervention measurements capture both immediate and delayed effects.

    To strengthen causal inferences despite the lack of randomization, researchers should:

    1. Match experimental and control groups as closely as possible on relevant variables

    2. Collect comprehensive data on potential confounding factors

    3. Use statistical techniques such as propensity score matching or regression discontinuity analysis to control for selection biases

    4. Implement multiple treatment times or intensities to establish dose-response relationships

    5. Triangulate findings using different perturbation methods (e.g., genetic knockout, domain-specific mutations, and protein knockdown)

    The multiple time-series design is particularly powerful as it allows researchers to distinguish treatment effects from maturation, testing effects, and instrumentation changes that might confound simpler designs .

  • What statistical approaches are most appropriate for analyzing phenotypic data from experiments involving UPF0694 transmembrane protein C14orf109 homolog?

    When analyzing phenotypic data from experiments involving UPF0694 transmembrane protein C14orf109 homolog, researchers should employ statistical approaches that account for the specific characteristics of developmental data in Xenopus models. The analysis strategy should address potential sources of variability while maximizing sensitivity to detect treatment effects .

    For quantitative phenotypic measurements:

    1. Descriptive statistics: Begin with measures of central tendency (mean, median) and variability (standard deviation, interquartile range) for each experimental group . Present these data in well-formatted tables that highlight the most pertinent comparisons rather than overwhelming readers with excessive details .

    2. Inferential statistics: Select appropriate tests based on data distribution and experimental design:

      • For normally distributed data: t-tests (paired or unpaired) for two-group comparisons or ANOVA for multi-group comparisons

      • For non-normally distributed data: Mann-Whitney U test, Kruskal-Wallis test, or other non-parametric alternatives

      • For repeated measurements: repeated measures ANOVA or mixed-effects models to account for within-subject correlations

    3. Regression analysis: When examining relationships between UPF0694 transmembrane protein expression levels and continuous phenotypic variables, regression models can quantify the strength and direction of associations .

    4. Effect size estimation: Report not only p-values but also effect sizes (Cohen's d, partial η²) to indicate the magnitude of observed effects . This facilitates comparison across studies and meta-analysis.

    A sample data presentation format for morphological phenotypes following UPF0694 transmembrane protein C14orf109 homolog perturbation might look like:

    Phenotypic measureControl (n=50)Knockdown (n=48)Overexpression (n=45)p-valueEffect size (η²)
    Body length (mm)10.2 ± 0.88.7 ± 1.2*11.1 ± 0.9*<0.0010.42
    Neural tube width (μm)125.3 ± 12.6138.7 ± 18.4*122.1 ± 13.20.0020.18
    Heart rate (bpm)78.5 ± 6.265.3 ± 8.7*84.2 ± 7.1*<0.0010.38

    *Significantly different from control group (p < 0.05 with Bonferroni correction)

    Remember to clearly state the specific statistical tests used and any corrections applied for multiple comparisons .

  • How can researchers effectively design and implement experimental controls when studying UPF0694 transmembrane protein C14orf109 homolog function in Xenopus tropicalis?

    Designing rigorous experimental controls is essential when investigating UPF0694 transmembrane protein C14orf109 homolog function in Xenopus tropicalis. A comprehensive control strategy should address multiple potential sources of experimental artifacts and biases .

    Essential control types for UPF0694 transmembrane protein studies:

    1. Genetic controls:

      • Negative controls: Include non-targeting CRISPR guides or scrambled morpholinos that match the GC content of experimental constructs but don't target any gene.

      • Specificity controls: Perform rescue experiments by co-injecting the morpholino or CRISPR/Cas9 along with mRNA encoding the wild-type protein (with modified sequence to avoid targeting).

      • Dose controls: Utilize multiple concentrations of morpholinos or CRISPR components to establish dose-response relationships.

    2. Technical controls:

      • Injection controls: Include uninjected embryos and embryos injected with vehicle only to control for mechanical damage.

      • Developmental stage controls: Match experimental groups precisely for developmental stage, as timing can significantly impact gene expression patterns.

      • Internal controls: Utilize the unique advantage of the 2-cell stage injection method in Xenopus, where one side of the embryo can serve as an internal control to the injected side .

    3. Validation controls:

      • Expression verification: Confirm knockdown or overexpression using RT-qPCR, Western blotting, or immunohistochemistry.

      • Phenotype specificity: Demonstrate that phenotypes are specific to UPF0694 transmembrane protein C14orf109 homolog by showing different genes produce distinct phenotypes.

      • Alternative approaches: Validate key findings using multiple independent methods (e.g., CRISPR/Cas9, morpholinos, and dominant-negative constructs).

    The internal control approach is particularly powerful in Xenopus. By injecting CRISPR components into one cell at the 2-cell stage, researchers create embryos where one half contains the mutation while the contralateral side remains wild-type . This within-animal control dramatically reduces variability from genetic background and environmental factors, increasing statistical power to detect subtle phenotypes with fewer animals.

  • What methods can be used to investigate the protein-protein interactions of UPF0694 transmembrane protein C14orf109 homolog in Xenopus tropicalis?

    Investigating protein-protein interactions (PPIs) of UPF0694 transmembrane protein C14orf109 homolog in Xenopus tropicalis requires specialized methodologies adapted for transmembrane proteins. The following approaches can be effectively implemented:

    1. Proximity labeling techniques:

      • BioID: Fuse the transmembrane protein to a promiscuous biotin ligase (BirA*) that biotinylates proteins in close proximity

      • APEX2: Fuse to an engineered ascorbate peroxidase that catalyzes biotin-phenol labeling of nearby proteins

      • These methods are particularly valuable for transmembrane proteins as they capture weak or transient interactions in their native cellular environment

    2. Co-immunoprecipitation with modifications for membrane proteins:

      • Use gentle detergents (e.g., digitonin, DDM, or CHAPS) that maintain membrane protein structure

      • Crosslink proteins prior to lysis to stabilize transient interactions

      • Verify interactions under different detergent conditions to distinguish specific from non-specific interactions

    3. Genetic code expansion for photo-crosslinking:

      • Incorporate photoreactive unnatural amino acids (like p-benzoyl-L-phenylalanine) into specific positions of the UPF0694 transmembrane protein using the genetic code expansion system established for Xenopus

      • UV irradiation then covalently crosslinks the transmembrane protein to its interaction partners

      • This approach allows for spatially and temporally controlled capture of protein interactions

    4. Split-reporter assays adapted for Xenopus:

      • Split-GFP complementation: Fuse fragments of GFP to the UPF0694 transmembrane protein and candidate interactors

      • Bimolecular fluorescence complementation (BiFC): Similar to split-GFP but with fluorescent proteins optimized for specific subcellular environments

      • These methods allow visualization of interactions in live embryos

    5. Yeast two-hybrid membrane system:

      • Use specialized membrane yeast two-hybrid systems (MYTH or split-ubiquitin) designed for transmembrane proteins

      • Clone the Xenopus tropicalis UPF0694 transmembrane protein C14orf109 homolog as bait and screen against Xenopus cDNA libraries

    For transmembrane proteins like UPF0694 C14orf109 homolog, combining multiple complementary approaches is recommended to distinguish true interactions from artifacts. Validation in the Xenopus system through co-localization studies, genetic interaction experiments, and functional assays provides confirmation of biologically relevant interactions.

  • How can researchers integrate multi-omics approaches to comprehensively study the function of UPF0694 transmembrane protein C14orf109 homolog in development and disease models?

    Integrating multi-omics approaches provides a comprehensive framework for understanding UPF0694 transmembrane protein C14orf109 homolog function in development and disease models. This integrated strategy combines data from multiple molecular levels to reveal emergent properties not evident from single-omics analyses .

    Multi-omics integration workflow for UPF0694 transmembrane protein C14orf109 homolog:

    1. Genomic analysis:

      • Identify conserved regulatory elements across species using comparative genomics

      • Characterize the genomic structure of TEgg078g21.1 gene and its chromosomal context

      • Investigate genetic variants in orthologous genes associated with human diseases

    2. Transcriptomic analysis:

      • Perform RNA-seq following genetic perturbation of UPF0694 transmembrane protein

      • Analyze temporal and spatial expression patterns during normal development

      • Identify co-expressed gene networks that may indicate functional relationships

    3. Proteomic analysis:

      • Conduct quantitative proteomics to measure protein abundance changes following perturbation

      • Identify post-translational modifications using phosphoproteomics, glycoproteomics, etc.

      • Map protein-protein interaction networks using proximity labeling approaches

    4. Metabolomic analysis:

      • Profile metabolic changes in tissues expressing mutant forms of the protein

      • Investigate membrane lipid composition alterations that may affect transmembrane protein function

      • Correlate metabolic signatures with phenotypic outcomes

    5. Phenomic analysis:

      • Implement high-content imaging of embryos with fluorescent reporters

      • Quantify morphological and behavioral phenotypes using automated image analysis

      • Track developmental trajectories across multiple timepoints

    Data integration strategies:

    Integration levelMethodologyApplication to UPF0694 transmembrane protein research
    Vertical integrationPathway mappingConnect genomic variants to transcriptional changes to protein function to phenotypic outcomes
    Horizontal integrationNetwork analysisIdentify hub genes/proteins that interact with UPF0694 across different tissues and developmental stages
    Temporal integrationTime-series analysisTrack dynamic changes in molecular networks during development following perturbation
    Cross-species integrationOrtholog mappingCompare function of C14orf109 homologs across model organisms to identify conserved mechanisms

    The Xenopus model offers unique advantages for this multi-omics approach due to its well-characterized developmental stages, the ability to obtain large numbers of synchronously developing embryos, and the feasibility of targeted genetic manipulations . By combining these data types, researchers can develop testable hypotheses about the mechanisms through which UPF0694 transmembrane protein C14orf109 homolog contributes to normal development and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.