Recombinant Xenopus tropicalis UPF0697 protein C8orf40 homolog

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

The UPF0697 protein C8orf40 homolog is a 101-amino-acid protein with a predicted molecular weight of ~11.5 kDa. Key features include:

PropertyDetails
Gene Namesmim19 (Small Integral Membrane Protein 19)
Expression SystemEscherichia coli with N-terminal His tag
Amino Acid SequenceMAGGYGVMADDGTIDYSVHEAWNEATNVYLIVILVSIGLFMYARKNKRKIMRIFTVPPTAESATEANFYDDMKKIRLRQQLEMYYIARKHEQNDSIQLTVE
Purity>90% by SDS-PAGE
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -20°C/-80°C

This protein lacks known functional domains but shares homology with human C8orf40, a poorly characterized protein implicated in cellular differentiation and disease .

Production and Quality Control

The recombinant protein is generated via bacterial expression followed by affinity chromatography. Critical production steps include:

  • Expression Optimization: Codon-adjusted smim19 ORF cloned into E. coli vectors for high-yield synthesis .

  • Purification: Immobilized metal affinity chromatography (IMAC) using the His tag .

  • Validation: Confirmed by mass spectrometry and N-terminal sequencing .

Limitations and Future Directions

No peer-reviewed studies specifically investigating X. tropicalis UPF0697 protein C8orf40 homolog were identified. Current data derive solely from commercial technical specifications . Future work should prioritize:

  • Functional Characterization: CRISPR/Cas9 knock-in/knockout studies in Xenopus embryos .

  • Interactome Mapping: Identification of binding partners via immunoprecipitation-mass spectrometry.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
smim19; Small integral membrane protein 19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
smim19
Target Protein Sequence
MAGGYGVMADDGTIDYSVHEAWNEATNVYLIVILVSIGLFMYARKNKRKIMRIFTVPPTA ESATEANFYDDMKKIRLRQQLEMYYIARKHEQNDSIQLTVE
Uniprot No.

Target Background

Database Links
Protein Families
SMIM19 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UPF0697 protein C8orf40 homolog in Xenopus tropicalis?

UPF0697 protein C8orf40 homolog is a small integral membrane protein found in Xenopus tropicalis (Western clawed frog). The protein consists of 101 amino acids with the UniProt ID A4QNL6 . It belongs to a family of uncharacterized proteins (UPF0697) that are homologous to the human C8orf40 protein. "UPF" designation indicates proteins identified through genomic studies whose functions have not yet been experimentally verified. The protein is particularly valuable for research due to its conservation across species and potential developmental roles.

How can researchers distinguish Xenopus tropicalis from related species when studying this protein?

Xenopus tropicalis can be distinguished from the related species Xenopus laevis through several morphological and genetic markers:

  • Size difference: Adult X. tropicalis are significantly smaller (4-6 cm) compared to X. laevis (5-14 cm) .

  • Call characteristics: X. tropicalis has a distinctive trill-type call with higher modulation intensity compared to X. laevis .

  • Anatomical differences: X. tropicalis has unfused nasal bones, absence of vomer bones, and fusion of the first two presacral vertebrae .

  • Genomic differences: X. tropicalis has a diploid genome with 10 chromosomes and genome size of approximately 1.5 Gb , whereas X. laevis is tetraploid.

When conducting protein studies, these distinctions are important for ensuring experiment reproducibility and proper interpretation of results.

What expression systems are optimal for recombinant production of Xenopus tropicalis UPF0697 protein?

Based on research findings, the following expression systems have proven effective:

  • E. coli expression system: The search results indicate successful expression in E. coli with an N-terminal His-tag fusion . This represents the most widely documented approach for this protein.

  • Methodological considerations for optimal expression:

    • Codon optimization may improve expression levels

    • Induction conditions should be optimized (temperature, IPTG concentration)

    • For membrane proteins like UPF0697, lower expression temperatures (16-20°C) often improve proper folding

    • Careful selection of E. coli strains (BL21(DE3), Rosetta, C41/C43) designed for membrane protein expression

The documented expression construct consists of the full-length protein (amino acids 1-101) with an N-terminal His tag , which facilitates subsequent purification while maintaining protein functionality.

What purification strategies yield the highest purity for this recombinant protein?

A multi-step purification strategy is recommended for achieving high purity (>90%) as documented in the search results :

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Utilizing the N-terminal His-tag for selective binding to Ni-NTA resin

    • Gradual elution with imidazole to minimize co-purification of contaminants

  • Additional purification considerations:

    • Buffer optimization: Tris-based buffers appear suitable for this protein

    • For membrane proteins, inclusion of appropriate detergents during extraction and purification maintains native conformation

    • Size exclusion chromatography as a polishing step improves homogeneity

  • Quality control:

    • SDS-PAGE analysis confirms purity >90%

    • Mass spectrometry can verify protein identity and integrity

This purification approach has proven successful in producing high-quality protein suitable for various research applications.

What are the optimal storage and handling conditions for maintaining protein stability?

According to the search results, the following conditions are recommended for optimal stability:

ParameterRecommendation
Storage temperature-20°C/-80°C for long-term storage
Storage formLyophilized powder or in solution with 50% glycerol
Buffer compositionTris-based buffer, pH 8.0 with 6% Trehalose
Working storageAliquots at 4°C for up to one week
Freeze-thaw cyclesMinimize; repeated cycles not recommended
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL

For reconstitution of lyophilized protein, the manufacturer recommends briefly centrifuging the vial prior to opening and adding 5-50% glycerol (final concentration) to aliquots for long-term storage . These conditions are essential for maintaining structural integrity and functional activity of this membrane protein.

What experimental approaches can elucidate the function of this uncharacterized protein?

Given that UPF0697 protein C8orf40 homolog remains functionally uncharacterized, several complementary experimental approaches are recommended:

  • Genetic manipulation in Xenopus tropicalis:

    • CRISPR-Cas9 genome editing to generate knockout models

    • Morpholino-based knockdown experiments in embryos

    • Phenotypic analysis of resulting models across developmental stages

  • Protein interaction studies:

    • Affinity purification with mass spectrometry (AP-MS) using the recombinant His-tagged protein

    • Yeast two-hybrid screening to identify binding partners

    • Co-immunoprecipitation experiments with candidate interacting proteins

  • Localization studies:

    • Immunofluorescence using antibodies against the native protein

    • Fusion with fluorescent proteins for live cell imaging

    • Subcellular fractionation followed by Western blotting

  • Bioinformatic analysis:

    • Sequence-based functional prediction

    • Structural modeling and comparison with proteins of known function

    • Phylogenetic analysis to identify evolutionary relationships

These approaches, particularly when used in combination, can provide comprehensive insights into the biological role of this uncharacterized protein.

How can researchers leverage Xenopus tropicalis as a model system for studying this protein?

Xenopus tropicalis offers several advantages as a model system for studying UPF0697 protein C8orf40 homolog:

  • Developmental biology applications:

    • Transparent embryos allow visualization of developmental processes

    • Large numbers of easily manipulated embryos facilitate experimental analysis

    • Relatively short generation time compared to X. laevis enables genetic studies

  • Genetic manipulation techniques:

    • Forward genetic screens have yielded developmental mutations

    • Gynogenetic diploid generation accelerates homozygous mutation analysis

    • Morpholino oligonucleotide injection effectively blocks translation of specific mRNAs

  • Transgenic approaches:

    • Restriction enzyme-mediated integration (REMI) generates non-mosaic transgenic animals

    • I-SceI meganuclease method produces non-mosaic embryos with 10% efficiency

    • Tol2 transposon-based methods and integrase φC31 provide alternative transgenic strategies

  • Comparative analysis:

    • Being diploid, X. tropicalis offers simpler genetic analysis than tetraploid X. laevis

    • Sequenced genome facilitates comparative genomic studies

These advantages make Xenopus tropicalis an excellent model for investigating the developmental functions of UPF0697 protein C8orf40 homolog.

What are the challenges in determining structure-function relationships for this protein?

Researchers face several challenges when investigating structure-function relationships of UPF0697 protein C8orf40 homolog:

  • Membrane protein structural analysis limitations:

    • Membrane proteins are notoriously difficult to crystallize

    • Hydrophobic regions may cause aggregation during purification

    • Detergent selection critically impacts native conformation preservation

  • Functional annotation challenges:

    • As an uncharacterized protein, no established functional assays exist

    • Potential functions must be inferred from sequence, structure, or interacting partners

    • Validation of putative functions requires development of specific assays

  • Expression system limitations:

    • E. coli expression may not recapitulate all post-translational modifications

    • Membrane protein folding may differ between expression systems

    • Tag interference with function must be carefully assessed

  • Technical considerations:

    • Small size (101 amino acids) may limit epitope availability for antibody generation

    • Potential for formation of protein complexes necessitates careful experimental design

    • Overlapping functional domains may complicate mutational analysis

Addressing these challenges requires integration of multiple experimental approaches and careful validation of results across different systems.

How can this protein be utilized in developmental studies of Xenopus tropicalis?

Recombinant Xenopus tropicalis UPF0697 protein can be employed in developmental studies through various approaches:

  • Expression analysis during development:

    • Temporal profiling across developmental stages

    • Spatial mapping using in situ hybridization

    • Correlation with specific developmental processes

  • Functional studies in embryos:

    • Microinjection of mRNA for overexpression studies

    • CRISPR-Cas9 knockout to assess loss-of-function phenotypes

    • Site-directed mutagenesis to evaluate structure-function relationships

  • Developmental pathway analysis:

    • Investigation of potential roles in known developmental signaling pathways

    • Identification of genetic interactions through combined knockdown experiments

    • Phenotypic rescue experiments to confirm specificity

  • Transgenic approaches:

    • Reporter constructs to visualize expression patterns

    • Inducible expression systems for temporal control

    • REMI and I-SceI meganuclease-mediated transgenesis techniques allow efficient creation of transgenic lines

These approaches leverage the unique advantages of Xenopus tropicalis as a model organism for developmental biology research.

What techniques are available for monitoring this protein's expression during development?

Researchers can employ multiple complementary techniques to monitor UPF0697 protein C8orf40 homolog expression during development:

  • Transcriptional analysis:

    • Quantitative PCR to measure mRNA levels across developmental stages

    • RNA-seq for genome-wide expression profiling

    • In situ hybridization to visualize spatial expression patterns

    • Single-cell RNA-seq for cell-type specific expression analysis

  • Protein detection methods:

    • Western blotting using stage-specific protein extracts

    • Immunohistochemistry to determine tissue localization

    • Mass spectrometry-based proteomic analysis for quantitative measurements

    • ELISA using recombinant protein standards

  • Live imaging approaches:

    • Fluorescent protein fusions for real-time expression monitoring

    • Transgenic reporter lines under native promoter control

    • Photoconvertible protein tagging for lineage tracing studies

  • Chromatin analysis:

    • ChIP-seq to identify transcriptional regulators binding the gene's promoter

    • ATAC-seq to assess chromatin accessibility at the locus during development

    • Chromosome conformation capture to identify long-range regulatory interactions

These methods provide complementary data on when, where, and how much of the protein is expressed during development.

How might this protein contribute to organ-specific development in Xenopus?

While the specific developmental functions of UPF0697 protein C8orf40 homolog remain to be elucidated, several potential contributions to organ development can be hypothesized:

  • Potential roles in organogenesis:

    • As a membrane protein, it may participate in cell adhesion or migration during tissue formation

    • Could function in cell-cell communication during tissue patterning

    • May contribute to establishment of tissue polarity

  • Organ-specific investigation approaches:

    • Heart development: Xenopus tropicalis is well-suited for studying cardiac development and function

    • Neural development: Transparent embryos facilitate visualization of neural tube formation

    • Kidney development: Pronephros formation is easily accessible in Xenopus embryos

  • Experimental design considerations:

    • Organ-specific knockdown using targeted injections

    • Tissue-specific overexpression using organ-specific promoters

    • Phenotypic analysis focusing on specific organs of interest

    • Time-series analysis targeting critical developmental windows

  • Integration with genetic screens:

    • Forward genetic screens have identified mutations affecting diverse aspects of embryogenesis including axial patterning, gut development, and organs such as the eye, ear, and heart

    • The protein could potentially be linked to these developmental processes through comparative genomic analysis

Understanding the potential organ-specific functions requires careful experimental design and integration of multiple datasets.

How can recombinant Xenopus tropicalis UPF0697 protein be used for antibody development?

Developing specific antibodies against UPF0697 protein C8orf40 homolog requires strategic planning:

  • Antigen design strategies:

    • Using the full-length recombinant protein (101 amino acids)

    • Selecting immunogenic peptide sequences from hydrophilic regions

    • Avoiding transmembrane domains that may be inaccessible in the native protein

    • Considering species cross-reactivity requirements

  • Production and purification approach:

    • Expression in E. coli with N-terminal His-tag as documented in search results

    • Purification to >90% purity using affinity chromatography

    • Quality control via SDS-PAGE and mass spectrometry

    • Appropriate buffer formulation for immunization

  • Validation methods:

    • Western blotting against native and recombinant protein

    • Immunoprecipitation efficiency testing

    • Immunohistochemistry on fixed tissues

    • Blocking experiments with recombinant protein

    • Testing in knockout/knockdown samples as negative controls

  • Applications of generated antibodies:

    • Developmental expression profiling

    • Subcellular localization studies

    • Protein-protein interaction analyses

    • Chromatin immunoprecipitation if nuclear functions are discovered

The recombinant protein available commercially provides a valuable starting point for antibody development projects.

What approaches can identify potential interaction partners of this protein?

Identifying interaction partners is crucial for understanding the function of UPF0697 protein C8orf40 homolog:

  • In vitro interaction studies:

    • Pull-down assays using His-tagged recombinant protein

    • Surface plasmon resonance to measure binding kinetics

    • Protein microarrays to screen for interactions

    • Cross-linking mass spectrometry to map interaction interfaces

  • Cell-based interaction studies:

    • Co-immunoprecipitation from Xenopus tropicalis tissues or cells

    • Proximity labeling techniques (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET)

    • Split-reporter complementation assays

  • Genetic interaction screens:

    • Combined knockdown/knockout experiments

    • Modifier screens in sensitized backgrounds

    • Synthetic lethality screening

    • Genetic rescue experiments

  • Computational predictions:

    • Protein-protein interaction databases

    • Co-expression analysis across developmental stages

    • Structural modeling of potential interaction interfaces

    • Evolutionary analysis of co-conserved protein families

A comprehensive interaction map would significantly advance understanding of this protein's biological role.

How can researchers leverage comparative genomics to understand UPF0697 protein evolution?

Comparative genomic approaches provide valuable insights into the evolutionary history and functional constraints of UPF0697 protein:

  • Cross-species comparative analysis:

    • Alignment with homologs from diverse vertebrate species

    • Identification of conserved domains and motifs

    • Analysis of selection pressure (dN/dS ratios) across protein regions

    • Correlation of conservation patterns with known protein domains

  • Genomic context analysis:

    • Examination of syntenic relationships across species

    • The Xenopus tropicalis genome contains 10 chromosomes with a total size of 1.5 Gb

    • Investigation of regulatory element conservation

    • Analysis of gene neighborhood conservation

  • Phylogenetic reconstruction:

    • Building protein family trees to understand evolutionary relationships

    • Dating gene duplication and speciation events

    • Identifying lineage-specific adaptations

    • Correlating with species-specific developmental features

  • Functional prediction:

    • Using conservation patterns to predict functional residues

    • Identifying co-evolving protein families as potential interaction partners

    • Leveraging evolutionary data to design targeted mutations

    • Distinguishing core functions from species-specific adaptations

Xenopus tropicalis, with its sequenced genome and position in vertebrate evolution, serves as an excellent model for such comparative studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.