Recombinant Xenopus tropicalis UPF0767 protein C1orf212 homolog (TGas122k06.1)
Description
Molecular Definition and Nomenclature
Recombinant Xenopus tropicalis UPF0767 protein C1orf212 homolog (TGas122k06.1) is a synthetic protein derived from the Xenopus tropicalis genome. It is a homolog to human C1orf212 and shares sequence identity with SMIM12 (Small Integral Membrane Protein 12), a gene involved in membrane-associated functions . The transcript identifier TGas122k06.1 and Uniprot ID Q28EM2 uniquely identify this protein .
Amino Acid Sequence
The protein spans residues 1–91 (91 amino acids) with the sequence:
MWPVLWAAARTYAPYITFPVAFVVGAVGYQLEWFIRGTPEQPVEELSILEKREERTLQETMGKDVTQVLSLKEKLEFTPKAVLNRNRQEKS .
| Feature | Detail |
|---|---|
| Gene Name | UPF0767 |
| Transcript ID | TGas122k06.1 |
| Uniprot ID | Q28EM2 |
| Species | Xenopus tropicalis (Western clawed frog) |
| Tag | Determined during production (e.g., His-tag in related homologs) |
Recombinant Protein Details
This protein is expressed in bacterial systems (e.g., E. coli) and purified to >90% purity .
Cross-Species Conservation
The Xenopus tropicalis UPF0767 homolog shares structural and functional similarities with SMIM12 proteins in other species.
| Species | Uniprot ID | AA Length | Homology | Source |
|---|---|---|---|---|
| Xenopus tropicalis | Q28EM2 | 91 | C1orf212/SMIM12 homolog | |
| Canis lupus familiaris | E2R5I0 | 92 | Full-length SMIM12 homolog |
Key differences include a 1-amino acid truncation in the Xenopus version compared to the dog homolog .
Experimental Utility
This recombinant protein is primarily used in:
-
ELISA assays for antibody validation or ligand-binding studies .
-
Protein interaction studies (e.g., co-IP, pull-down assays) .
-
Transgenic research in Xenopus models to study gene function .
Challenges and Considerations
-
Sequence Variability: Minor differences in AA sequence (e.g., between Xenopus and dog homologs) may affect epitope recognition in assays .
-
Tag Optimization: The choice of affinity tags (e.g., His, Avi) impacts purification efficiency and downstream applications .
-
Stability: Glycerol content and storage conditions are critical to maintaining protein activity .
Product Specs
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance for an additional fee.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
