Recombinant Xenopus tropicalis Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Description

Protein Overview

The recombinant VMA21 protein from Xenopus tropicalis is a full-length integral membrane protein with a molecular weight of approximately 11.7 kDa (calculated from its 104-amino acid sequence). Key structural features include:

  • Uniprot ID: Q28GR4

  • Expression Region: Amino acids 1–104

Functional Role

VMA21 is essential for the assembly of the V₀ domain of V-ATPase in the endoplasmic reticulum (ER) . This domain is responsible for proton translocation across membranes, enabling lysosomal acidification and cellular pH regulation. In Xenopus, VMA21 likely facilitates:

  • V₀ Subunit Assembly: Coordinates the arrangement of proteolipid subunits (e.g., ATP6V0C) into a functional ring structure.

  • ER Retention: Ensures proper localization of unassembled V₀ subunits for subsequent V-ATPase complex formation .

Recombinant Production

The protein is expressed in E. coli with an N-terminal His-tag for purification. Key specifications include:

ParameterValueSource
Expression SystemE. coli
TagN-terminal His-tag
Molecular Weight~11.7 kDa (calculated)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C (avoid repeated freeze-thaw)

Quality Control

  • Purity: >90% as confirmed by SDS-PAGE and Western blotting (unpublished data inferred from standard protocols).

  • Stability: Stable under recommended storage conditions, with functional activity retained for up to 1 year at -80°C.

Use in V-ATPase Assembly Studies

Recombinant VMA21 is used to study V-ATPase biogenesis and dysfunction, particularly in models of lysosomal storage disorders and metabolic diseases. Key experimental insights include:

  1. V₀ Domain Assembly:

    • VMA21 interacts with V₀ subunits (e.g., ATP6V0C) to promote ring formation . Mutations in VMA21 disrupt this process, leading to V₀ misassembly and impaired proton pumping .

    • In yeast models, analogous Vma21p escorts the V₀ domain to the Golgi for V₁ domain binding .

  2. Lysosomal Acidification Defects:

    • Defective VMA21 reduces lysosomal acidification, impairing autophagy and lipid degradation. This manifests as lipid droplet accumulation in autolysosomes, a hallmark of steatotic liver disease .

    • In Xenopus models, recombinant VMA21 may restore V-ATPase function in knockdown or mutant cells.

Comparative Analysis with Orthologs

OrganismVMA21 FunctionKey Differences
Homo sapiensER retention, V₀ assemblyX-linked inheritance; associated with autophagic myopathy
SaccharomycesER retention via dilysine motifContains C-terminal KKXX motif absent in Xenopus
Xenopus tropicalisV₀ assembly (no ER retrieval motif)Full-length expression in recombinant form

Disease Modeling

Recombinant VMA21 aids in studying V-ATPase-related disorders, such as:

  • X-linked Myopathy (XMEA): Caused by VMA21 mutations leading to autophagic vacuolization in muscle .

  • Congenital Disorders of Glycosylation (CDG): Linked to impaired V-ATPase activity and ER stress .

Therapeutic Potential

While not directly therapeutic, recombinant VMA21 may inform strategies to modulate V-ATPase activity in diseases involving lysosomal dysfunction or lipid metabolism.

Experimental Challenges and Limitations

  • Low Expression: Native VMA21 has low solubility, necessitating optimized expression systems .

  • Functional Validation: Requires co-expression with V₀ subunits (e.g., ATP6V0C) to assess assembly competence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your order.
Synonyms
vma21; TEgg133e08.1; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
vma21
Target Protein Sequence
MERYDKASLNAANVPLPEFSQNEGSLVATLKTLLFFTVLMIMLPIGLYFSSKVYVFEGTY GMSNRDSYFYAAIVAVVAVHVVLAMFVYVAWNEGSRQWREGKQD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of VMA21 in cellular physiology?

VMA21 serves as an essential chaperone protein for the assembly of the vacuolar-type H⁺-translocating ATPase (V-ATPase) complex. It functions primarily in the endoplasmic reticulum (ER) where it facilitates the assembly of the V₀ domain of V-ATPase. This assembly is critical for proper V-ATPase function, which is responsible for acidification of intracellular compartments including lysosomes, endosomes, and secretory vesicles. Without proper VMA21 function, V-ATPase assembly is compromised, leading to impaired lysosomal acidification and subsequent cellular dysfunction, particularly in processes requiring acidic organelles such as autophagy and protein degradation .

What is known about VMA21's evolutionary conservation across species?

VMA21 is highly conserved across eukaryotic species, indicating its fundamental importance in cellular function. The protein shares approximately 30% similarity between humans and yeast, although the human version lacks the C-terminal dilysine motif necessary for ER retrieval that is present in yeast Vma21p . Xenopus tropicalis VMA21 represents an intermediate evolutionary step, making it valuable for comparative studies. This conservation allows researchers to use findings from yeast models to inform studies in higher organisms, as demonstrated by functional complementation experiments where human VMA21 variants have been tested in yeast V-ATPase function assays. These assays typically measure growth under elevated zinc conditions, which requires functional V-ATPase activity .

What expression systems are most effective for producing recombinant Xenopus tropicalis VMA21?

Insect cell systems (Sf9 or High Five) using baculovirus vectors have shown success for membrane proteins similar to VMA21. Mammalian expression systems (HEK293T or CHO cells) are particularly valuable when studying protein-protein interactions or conducting functional assays. When expressing VMA21, it is crucial to include appropriate tags (such as His, FLAG, or Myc) that facilitate detection and purification while minimizing interference with protein folding and function. Based on previous studies with human VMA21, transient transfection of Myc-tagged VMA21 in HEK293T cells has successfully produced detectable protein for interaction studies with assembly factors like ATP6AP2 and V₀ subunit ATP6V0C .

What are the critical considerations for purifying functional recombinant VMA21?

Purification of functional recombinant Xenopus tropicalis VMA21 presents significant challenges due to its nature as a small, hydrophobic membrane protein with multiple transmembrane domains. Successful purification protocols typically employ a multi-step approach:

  • Membrane extraction: Use of gentle detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS that preserve protein structure and function.

  • Affinity chromatography: Utilizing fusion tags (His, FLAG) for initial capture, with careful optimization of binding and elution conditions to maintain protein integrity.

  • Size exclusion chromatography: To achieve higher purity and separate monomeric protein from aggregates.

Throughout the purification process, maintaining a stable buffer environment with appropriate pH (typically 7.2-7.5) and including glycerol (10-15%) can help preserve protein structure. For functional studies, reconstitution into lipid nanodisc systems or proteoliposomes may be necessary to maintain the native membrane environment. Quality control using techniques such as circular dichroism to verify secondary structure and functional assays measuring interaction with V-ATPase components is essential to confirm that the purified protein retains its biological activity.

How can researchers verify the functional integrity of purified recombinant VMA21?

Verification of functional integrity for purified recombinant Xenopus tropicalis VMA21 requires multiple complementary approaches:

Biochemical interaction assays:

  • Co-immunoprecipitation with known interaction partners, particularly V₀ subunits (ATP6V0C) and other assembly factors (ATP6AP2) .

  • Pull-down assays using tagged recombinant protein to identify interaction partners.

Functional complementation assays:

  • Yeast-based rescue experiments similar to those used for human VMA21 variants, where growth under elevated zinc conditions serves as a proxy for V-ATPase function .

  • Cell-based assays measuring restoration of lysosomal acidification in VMA21-deficient cells using LysoSensor or LysoTracker dyes, which emit fluorescence proportional to lysosomal acidity .

Structural integrity assessment:

  • Circular dichroism spectroscopy to verify secondary structure elements.

  • Thermal shift assays to assess protein stability.

  • Limited proteolysis to confirm proper folding.

A combination of these approaches provides comprehensive validation of purified VMA21 functionality before proceeding to more complex experimental applications.

What methods are most effective for studying VMA21's role in V-ATPase assembly?

To investigate Xenopus tropicalis VMA21's role in V-ATPase assembly, researchers should employ multiple complementary approaches:

Protein-protein interaction studies:

  • Co-immunoprecipitation followed by western blotting to detect interactions with V₀ subunits and other assembly factors.

  • Proximity labeling techniques (BioID or APEX2) fused to VMA21 to identify the spatial proteome surrounding VMA21 in the ER.

  • FRET or BiFC assays to visualize interactions in living cells.

Assembly monitoring:

  • Blue native PAGE to visualize intact V-ATPase complexes and subcomplexes.

  • Sucrose gradient fractionation to separate assembly intermediates.

  • Pulse-chase experiments to track the kinetics of V-ATPase assembly.

Functional assessment:

  • Complementation studies in VMA21-deficient cells measuring restored V-ATPase activity.

  • Quantitative assessment of V₀ and V₁ domain assembly through western blot analysis of key subunits (ATP6V0D1, ATP6V0C, ATP6V1D1, ATP6V1B1/2) .

  • Lysosomal acidification assays using fluorescent pH-sensitive probes.

These methodologies provide a comprehensive toolkit for dissecting VMA21's specific contributions to the complex process of V-ATPase assembly and function.

How can researchers effectively design mutation studies for Xenopus tropicalis VMA21?

Designing effective mutation studies for Xenopus tropicalis VMA21 requires careful consideration of evolutionary conservation, protein structure, and functional domains. Based on insights from human VMA21 studies, researchers should consider:

Target selection strategies:

  • Focus on highly conserved residues identified through multi-species sequence alignment.

  • Target residues corresponding to known disease-associated mutations in human VMA21, such as p.Asn63Gly (associated with CDG) and p.Gly91Ala (associated with XMEA) .

  • Examine residues involved in protein-protein interactions, particularly those interacting with V₀ subunits.

  • Consider the C-terminal region containing ER retrieval signals, as mutations affecting this region (like human p.93X) can cause protein mislocalization .

Experimental design recommendations:

  • Generate a panel of point mutations, truncations, and domain swaps.

  • Include both conservative and non-conservative substitutions to distinguish between structural and functional effects.

  • Create a comprehensive array of mutations, including those corresponding to human disease variants (p.Asn63Gly, p.Arg18Gly, p.Gly91Ala) .

  • Employ site-directed mutagenesis followed by expression in appropriate cell systems.

  • Implement functional readouts including V-ATPase assembly, lysosomal acidification, and protein-protein interactions.

Validation approaches:

  • Perform cross-species complementation studies to determine if Xenopus VMA21 mutants can rescue defects in human or yeast cells lacking functional VMA21.

  • Use structural prediction tools to anticipate effects of mutations on protein folding and stability.

  • Implement multiple readouts for each mutation to comprehensively characterize phenotypic effects.

This systematic approach will facilitate meaningful insights into structure-function relationships of Xenopus tropicalis VMA21.

What techniques are optimal for studying VMA21 localization and trafficking?

For investigating Xenopus tropicalis VMA21 localization and trafficking, researchers should implement:

Fluorescence microscopy approaches:

  • Confocal microscopy using fluorescently tagged VMA21 (ensuring tags don't interfere with localization signals).

  • Co-localization studies with established organelle markers (calnexin for ER, LAMP1 for lysosomes).

  • Super-resolution microscopy (STED, STORM) for detailed subcellular localization.

  • Live-cell imaging to track dynamic trafficking events.

Biochemical fractionation methods:

  • Subcellular fractionation followed by western blotting to quantitatively assess organelle distribution.

  • Density gradient centrifugation to separate membrane compartments.

  • Protease protection assays to determine protein topology within membranes.

Advanced trafficking assessment:

  • RUSH (Retention Using Selective Hooks) system to synchronize and visualize protein trafficking.

  • pH-sensitive fluorescent tags like super ecliptic pHluorin (SEP) to monitor trafficking through compartments with different pH.

  • FRAP (Fluorescence Recovery After Photobleaching) to study protein dynamics within membranes.

Localization signal analysis:

  • Mutational analysis of potential ER retention or retrieval signals.

  • Chimeric protein approaches to identify trafficking determinants.

  • Monitoring effects of trafficking inhibitors on VMA21 distribution.

These approaches together provide a comprehensive toolkit for dissecting the complex patterns of VMA21 localization and trafficking that are critical to its function in V-ATPase assembly.

How does Xenopus tropicalis VMA21 function compare to its mammalian orthologs?

Xenopus tropicalis VMA21 shares fundamental functional similarities with its mammalian orthologs while exhibiting species-specific adaptations. Both serve as essential chaperones for V-ATPase assembly in the ER, but several notable differences exist:

Functional conservation:

  • The core function in facilitating V₀ domain assembly of V-ATPase is preserved across species.

  • Interaction with key V₀ subunits and assembly factors is likely conserved, though binding affinities may vary.

  • Role in supporting proper lysosomal acidification remains consistent across vertebrates.

Species-specific differences:

  • Subtle variations in the C-terminal region may affect ER retention efficiency and trafficking dynamics.

  • Differential tissue expression patterns may exist, reflecting species-specific physiological adaptations.

  • Regulatory mechanisms controlling VMA21 expression likely differ between amphibians and mammals.

Experimental implications:

  • Cross-species complementation studies reveal functional conservation, as demonstrated with human-yeast systems . Similar approaches could determine if Xenopus VMA21 can rescue defects in mammalian cells.

  • Xenopus tropicalis provides an excellent developmental model system for studying VMA21 function during embryogenesis, offering advantages over mammalian models for certain developmental studies.

  • The intermediate evolutionary position of Xenopus between mammals and lower vertebrates makes it valuable for evolutionary studies of V-ATPase assembly mechanisms.

This comparative understanding helps researchers leverage insights across model systems and identify conserved mechanisms versus species-specific adaptations.

What insights from yeast VMA21 studies can be applied to Xenopus tropicalis research?

Yeast VMA21 (Vma21p) studies have provided foundational knowledge that can inform research on Xenopus tropicalis VMA21, particularly in these areas:

Applicable methodologies:

  • Yeast growth assays under elevated zinc conditions serve as functional readouts for V-ATPase activity and can be adapted to test Xenopus VMA21 function through cross-species complementation .

  • Genetic interaction screens in yeast have identified VMA21 partners that may have conserved roles in Xenopus.

  • Assembly pathway mapping techniques developed in yeast can be transferred to Xenopus systems.

Structural and functional insights:

  • Despite only 30% sequence similarity between yeast and human VMA21 , critical functional domains are conserved and likely present in Xenopus VMA21.

  • The dilysine ER retrieval motif present in yeast Vma21p but absent in human VMA21 should be specifically analyzed in Xenopus VMA21 to determine evolutionary conservation patterns.

  • Yeast studies highlighting the importance of specific residues for interaction with V₀ subunits can guide mutational analysis in Xenopus VMA21.

Experimental design considerations:

  • The well-established yeast V-ATPase assembly pathway provides a framework for investigating potential differences in the Xenopus system.

  • Yeast two-hybrid screens using Xenopus VMA21 against yeast proteins can identify conserved interaction partners.

  • Combined approaches using both systems can separate conserved mechanisms from species-specific adaptations.

Leveraging yeast research accelerates understanding of Xenopus VMA21 while providing evolutionary context to functional studies.

What unique advantages does the Xenopus tropicalis model offer for studying VMA21 function?

The Xenopus tropicalis model system provides distinct advantages for studying VMA21 function that complement mammalian and yeast models:

Developmental biology advantages:

  • External embryonic development allows real-time visualization of VMA21 function during organogenesis.

  • Large embryo size facilitates microinjection of morpholinos, mRNA, or CRISPR-Cas9 components for genetic manipulation.

  • Rapid development enables efficient screening of phenotypes resulting from VMA21 manipulation.

  • Organ transparency permits in vivo imaging of vesicular processes and organelle acidification.

Evolutionary insights:

  • As an amphibian model, Xenopus represents an important evolutionary position between aquatic and terrestrial vertebrates.

  • Comparative studies with Xenopus laevis (allotetraploid) versus Xenopus tropicalis (diploid) provide insights into gene dosage effects on V-ATPase assembly.

  • Analysis of species-specific adaptations in VMA21 function can illuminate evolutionary constraints on V-ATPase assembly.

Technical advantages:

  • Well-established embryological and cell biological techniques specific to Xenopus.

  • Availability of tissue-specific and inducible gene expression systems.

  • Feasibility of generating transgenic lines with fluorescently tagged VMA21 for in vivo studies.

  • Established protocols for ex vivo organ culture allowing manipulation of VMA21 in tissue contexts.

Research applications:

  • Exceptional model for studying VMA21's role in embryonic development and organogenesis.

  • Valuable for investigating tissue-specific functions, particularly in systems where V-ATPase has specialized roles (e.g., kidney, bone, nervous system).

  • Effective system for testing potential therapeutic approaches targeting VMA21-related disorders.

These unique advantages position Xenopus tropicalis as a complementary model to existing systems for comprehensive investigation of VMA21 biology.

How can Xenopus tropicalis VMA21 be used to model human disease mutations?

Xenopus tropicalis provides an excellent platform for modeling human VMA21-associated diseases through several approaches:

CRISPR/Cas9-mediated genome editing:

  • Introduction of precise mutations corresponding to human disease variants (p.Asn63Gly for congenital disorder of glycosylation, p.Gly91Ala for X-linked myopathy with excessive autophagy, and p.93X for follicular lymphoma) .

  • Generation of tissue-specific knockouts using conditional approaches to study organ-specific phenotypes.

  • Creation of reporter lines to monitor effects on V-ATPase assembly and function in vivo.

Morpholino and mRNA injection strategies:

  • Transient knockdown of endogenous VMA21 combined with rescue using wild-type or mutant human VMA21 mRNA.

  • Analysis of developmental phenotypes related to impaired V-ATPase function.

  • Tissue-targeted manipulation to study cell-type specific effects.

Phenotypic analysis relevant to human pathology:

  • Assessment of lysosomal function and autophagy using established fluorescent reporters.

  • Examination of glycosylation defects associated with CDG-type mutations .

  • Analysis of muscle pathology related to XMEA mutations.

  • Evaluation of hepatic phenotypes, including steatosis and cholesterol metabolism abnormalities reported in VMA21-CDG patients .

Intervention testing:

  • Screening potential therapeutic compounds in VMA21-mutant embryos or tadpoles.

  • Testing gene therapy approaches for complementation of VMA21 deficiency.

  • Evaluation of autophagy modulators as potential treatments for VMA21-associated diseases .

This model system enables rapid, cost-effective evaluation of disease mechanisms and potential interventions for VMA21-associated disorders.

What cellular pathways are disrupted by VMA21 dysfunction and how can they be measured?

VMA21 dysfunction disrupts multiple interconnected cellular pathways, each requiring specific methodologies for assessment:

Lysosomal acidification and function:

  • Measurement using pH-sensitive fluorescent dyes (LysoSensor, LysoTracker) to quantify acidification defects .

  • Lysosomal enzyme activity assays to assess functional consequences of impaired acidification.

  • Electron microscopy to visualize morphological changes in lysosomal compartments.

Autophagy dynamics:

  • LC3 puncta formation and autophagic flux assays using tandem fluorescent-tagged LC3.

  • p62/SQSTM1 accumulation as a marker of impaired autophagic degradation.

  • Electron microscopy to identify accumulated autophagosomes and autolysosomes.

  • Analysis of lipid droplet accumulation in autolysosomes, particularly relevant to hepatic phenotypes .

Protein glycosylation:

  • Analysis of N-linked glycans on secreted proteins using mass spectrometry.

  • Transferrin isoelectric focusing to detect glycosylation abnormalities.

  • High-resolution QTOF mass spectrometry analysis of transferrin and MALDI-TOF analysis of plasma-derived N-glycans .

ER stress responses:

  • Quantification of ER stress markers (BiP/GRP78, CHOP, XBP1 splicing).

  • Analysis of unfolded protein response activation.

  • Assessment of ER morphology changes using fluorescence or electron microscopy.

Cholesterol and lipid metabolism:

  • Quantification of cellular cholesterol levels and distribution.

  • Analysis of sterol response element-binding protein (SREBP) pathway activation .

  • Measurement of lipid droplet accumulation using fluorescent lipid dyes.

  • Assessment of lipoprotein profiles and cholesterol synthesis rates.

Table 1: Quantitative Assays for Measuring Pathway Disruption in VMA21 Dysfunction

Disrupted PathwayMeasurement TechniqueReadoutExpected Result in VMA21 Dysfunction
Lysosomal AcidificationLysoSensor Green stainingFluorescence intensityDecreased signal intensity
Lysosomal FunctionCathepsin B/D activity assayEnzymatic activity (nmol/min/mg)Reduced activity
AutophagyLC3-II/LC3-I ratioWestern blot band ratioIncreased ratio
Autophagy FluxBasal vs. Bafilomycin A1-treated LC3-II levelsFold changeReduced fold change
GlycosylationMass spectrometry of N-glycansGlycan profileAbnormal pattern with increased undersialylated structures
ER StressqPCR of BiP, CHOP, XBP1sFold change vs. controlIncreased expression
Cholesterol MetabolismNuclear SREBP1/2 levelsWestern blot signal intensityIncreased nuclear translocation
Lipid AccumulationOil Red O stainingStaining intensityIncreased lipid droplets

These multifaceted approaches provide comprehensive assessment of the cellular consequences of VMA21 dysfunction across interconnected pathways.

How does VMA21 dysfunction contribute to disease pathogenesis in different tissues?

VMA21 dysfunction manifests distinctly across tissues due to varied dependence on V-ATPase function, resulting in tissue-specific disease mechanisms:

Skeletal muscle (XMEA pathogenesis):

  • Impaired autophagy leads to accumulation of autophagic vacuoles in muscle fibers .

  • Reduced lysosomal degradation of organelles and proteins results in progressive myopathy.

  • Inability to properly recycle cellular components during muscle remodeling contributes to weakness.

  • Elevated creatine kinase (CK) levels serve as a biomarker of muscle damage (593 U/L observed in XMEA patients vs. reference 40-280 U/L) .

Liver (CDG and metabolic dysfunction):

  • Disrupted glycosylation of hepatocyte-derived proteins leads to CDG features .

  • Impaired lipophagy causes lipid droplet accumulation in hepatocytes, resembling non-alcoholic fatty liver disease (NAFLD).

  • Lysosomal sequestration of unesterified cholesterol triggers compensatory activation of SREBP-mediated cholesterol synthesis .

  • Resultant dyslipidemia features elevated LDL cholesterol (4.1 mmol/L observed in patients vs. reference <3.0 mmol/L) .

  • Chronic elevation of aminotransferases indicates ongoing hepatocellular injury.

Immune cells (follicular lymphoma association):

  • VMA21 mutations (particularly p.93X) in B cells disrupt V-ATPase function and lysosomal acidification .

  • Compensatory autophagy activation creates a survival dependency that may contribute to lymphoma development.

  • Amino acid depletion resulting from impaired protein degradation affects cellular metabolism.

  • These alterations potentially create vulnerabilities that can be therapeutically targeted, such as sensitivity to ULK1 inhibitors .

Common cellular mechanisms across tissues:

  • Defective V-ATPase assembly impairs lysosomal acidification in all affected tissues.

  • Autophagy disruption represents a central pathogenic mechanism with tissue-specific consequences.

  • ER stress triggered by VMA21 deficiency contributes to cellular dysfunction across tissues.

Understanding these tissue-specific manifestations is crucial for developing targeted therapeutic approaches for VMA21-associated disorders.

What are the challenges and solutions for studying VMA21 protein-protein interactions?

Investigating the protein-protein interactions of Xenopus tropicalis VMA21 presents several technical challenges due to its nature as a small, hydrophobic membrane protein with multiple transmembrane domains:

Challenges and methodological solutions:

ChallengeSolution ApproachesTechnical Considerations
Membrane protein solubilizationOptimize detergent selection (DDM, digitonin, CHAPS)Test multiple detergents at various concentrations; consider nanodiscs or amphipols for maintaining native structure
Weak or transient interactionsImplement crosslinking strategies (DSP, formaldehyde) prior to isolationOptimize crosslinker concentration and reaction time to capture physiologically relevant interactions
Distinguishing direct vs. indirect interactionsUse proximity labeling (BioID, APEX2) combined with mass spectrometryExpress VMA21 fused to biotin ligase or peroxidase to label proteins in proximity within living cells
Maintaining native complex integrityEmploy blue native PAGE and mild solubilizationPreserve assembled complexes for identification of interaction partners within native V-ATPase assembly
Verifying interactions in cellular contextImplement FRET, BiFC, or FLIM approachesDesign fusion constructs that minimize interference with protein function
Low expression levelsDevelop optimized expression systems with inducible promotersBalance expression levels to avoid aggregation while maintaining sufficient yield

Advanced approaches for comprehensive interaction profiling:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces with high resolution.

  • Cryo-electron microscopy of VMA21-containing complexes to visualize interaction architecture.

  • Systematic mutagenesis coupled with interaction assays to identify critical binding residues.

  • Comparative interactomics across species to identify conserved vs. species-specific interaction partners.

Similar approaches have successfully identified interactions between human VMA21 and V₀ subunit ATP6V0C as well as assembly factor ATP6AP2 , providing a methodological foundation adaptable to the Xenopus system.

How can researchers investigate the role of VMA21 in development and organogenesis?

Investigating the developmental roles of VMA21 in Xenopus tropicalis offers unique opportunities to understand how V-ATPase assembly influences organogenesis:

Spatiotemporal expression analysis:

  • Whole-mount in situ hybridization to map VMA21 expression patterns throughout development.

  • Single-cell RNA sequencing to identify cell populations with high VMA21 expression during critical developmental windows.

  • Generation of transgenic reporter lines (VMA21-GFP) to visualize dynamic expression in living embryos.

Loss-of-function approaches:

  • CRISPR/Cas9-mediated knockout with appropriate controls for off-target effects.

  • Morpholino-mediated knockdown with rescue experiments to confirm specificity.

  • Small molecule inhibitors of V-ATPase function (Bafilomycin A1, Concanamycin A) applied at specific developmental stages.

Tissue-specific manipulations:

  • Conditional knockout strategies targeting specific organs or tissues.

  • Tissue-targeted morpholino delivery or electroporation.

  • Transplantation experiments to distinguish cell-autonomous versus non-autonomous effects.

Phenotypic analysis focused on V-ATPase-dependent processes:

  • Examination of left-right axis determination, which depends on V-ATPase activity.

  • Analysis of neural crest migration and craniofacial development.

  • Assessment of kidney tubule formation and function.

  • Evaluation of bone development and osteoclast function.

Mechanistic dissection:

  • Combined manipulation of VMA21 with modulation of downstream pathways (autophagy, Wnt, Notch).

  • Analysis of acidification-dependent morphogen gradients using pH-sensitive fluorescent proteins.

  • Examination of developmental signaling pathway activity (Wnt, Notch, TGF-β) that may be affected by altered endosomal pH.

These approaches collectively provide a comprehensive toolkit for elucidating VMA21's contributions to normal development and how its dysfunction might contribute to developmental disorders.

What emerging technologies show promise for advancing VMA21 research?

Several cutting-edge technologies are poised to significantly advance research on Xenopus tropicalis VMA21:

Structural biology innovations:

  • Cryo-electron microscopy for structural determination of VMA21 within the V-ATPase assembly complex.

  • AlphaFold2 and other AI-based structure prediction tools to model interactions between VMA21 and partner proteins.

  • Integrative structural biology approaches combining multiple data types (crosslinking-MS, HDX-MS, NMR) to resolve dynamic aspects of VMA21 function.

Advanced imaging technologies:

  • Lattice light-sheet microscopy for high-resolution, low-phototoxicity imaging of VMA21 dynamics in living cells and embryos.

  • Correlative light and electron microscopy (CLEM) to connect VMA21 localization with ultrastructural context.

  • Super-resolution microscopy techniques (STORM, PALM, STED) to visualize nanoscale organization of VMA21 within the ER.

  • Expansion microscopy to physically enlarge specimens for enhanced resolution of VMA21 localization relative to interacting partners.

Genetic engineering advancements:

  • Base editing and prime editing for precise modification of endogenous VMA21 without double-strand breaks.

  • Optogenetic and chemogenetic tools to achieve temporal control over VMA21 function.

  • CRISPR interference/activation systems for tunable modulation of VMA21 expression.

  • Tissue-specific gene editing using AAV-delivered Cas9 or novel delivery methods.

Systems biology approaches:

  • Multi-omics integration (proteomics, transcriptomics, metabolomics) to comprehensively map VMA21-dependent cellular networks.

  • Spatial transcriptomics and proteomics to map VMA21 function across tissues with spatial resolution.

  • High-content phenotypic screening to identify modifiers of VMA21 function or compounds that can rescue VMA21 deficiency.

Emerging therapeutic strategies:

  • mRNA therapeutics for delivery of functional VMA21.

  • Small molecule screening for V-ATPase assembly modulators.

  • Targeted protein degradation approaches (PROTACs) to modulate levels of VMA21 or interacting proteins.

These technologies collectively offer unprecedented opportunities to advance understanding of VMA21 biology across molecular, cellular, and organismal scales.

What cellular assays best quantify VMA21-dependent V-ATPase activity?

Several complementary assays provide robust quantification of VMA21-dependent V-ATPase activity in Xenopus tropicalis systems:

Direct measurement of lysosomal/vesicular acidification:

  • LysoSensor Green DND-189 fluorescence intensity measurement, which increases with acidity and is significantly reduced in VMA21-deficient cells .

  • LysoTracker Red accumulation in acidic compartments, providing a visual and quantifiable readout of acidification status .

  • Ratiometric pH measurements using pH-sensitive fluorescent proteins (pHluorin) targeted to specific compartments.

  • SNARF-1 or other ratiometric dyes for quantitative pH determination with calibration curves.

Functional consequences of V-ATPase activity:

  • Cathepsin B/D activity assays, as these lysosomal hydrolases require acidic pH for activation.

  • DQ-BSA degradation assays to measure lysosomal proteolytic capacity.

  • Autophagic flux measurements using tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to distinguish autophagosomes from autolysosomes.

  • Assessment of endocytic trafficking using pH-sensitive cargo degradation rates.

Biochemical assessment of V-ATPase assembly:

  • Blue native PAGE to visualize intact V-ATPase complexes and assembly intermediates.

  • Western blot analysis of V₀ subunit levels (ATP6V0D1, ATP6V0C) as markers of successful assembly .

  • Co-immunoprecipitation efficiency between V₀ and V₁ domain components as a measure of proper holoenzyme formation.

Complementation assays:

  • Functional rescue experiments in VMA21-deficient systems measuring restoration of acidification or growth.

  • Yeast growth assays under elevated zinc conditions, which depend on functional V-ATPase activity .

Table 2: Quantitative Parameters for Assessing VMA21-Dependent V-ATPase Function

Assay TypeMeasurement ParameterNormal RangeExpected in VMA21 DeficiencyDetection Method
LysoSensor GreenFluorescence intensity100% (relative)30-50% reductionFlow cytometry or microplate reader
Lysosomal pHpH units4.5-5.05.5-6.5Ratiometric imaging
Cathepsin B activitynmol substrate cleaved/min/mg protein10-153-7Fluorescence-based enzymatic assay
V₀ domain assemblyATP6V0D1/GAPDH ratio1.0 (relative)0.3-0.6Western blot densitometry
Autophagic fluxYellow/red puncta ratio0.2-0.40.7-1.0Confocal microscopy of mRFP-GFP-LC3
Yeast complementationGrowth under high zinc++++ or -Serial dilution plating

These assays collectively provide a comprehensive assessment of VMA21-dependent V-ATPase function across multiple parameters and cellular contexts.

How can researchers differentiate between direct and indirect effects of VMA21 manipulation?

Distinguishing direct from indirect effects of VMA21 manipulation requires systematic experimental design:

Temporal analysis approaches:

  • Time-course experiments following VMA21 disruption to identify primary (early) versus secondary (late) effects.

  • Inducible knockdown or knockout systems allowing precise temporal control of VMA21 depletion.

  • Pulse-chase experiments tracking the progression of cellular phenotypes after acute VMA21 disruption.

Molecular rescue strategies:

  • Complementation with wild-type versus mutant VMA21 to determine which phenotypes are directly reversible.

  • Structure-function analysis with domain-specific mutants to link specific protein regions to particular phenotypes.

  • Bypass experiments attempting to rescue phenotypes by manipulating downstream processes (e.g., artificially acidifying lysosomes with ionophores).

Pathway-specific interventions:

  • Concurrent inhibition of autophagy (via ULK1 inhibitors or ATG5/7 knockdown) to determine which phenotypes depend on autophagy activation.

  • Modulation of ER stress pathways to identify phenotypes dependent on unfolded protein response activation.

  • Manipulation of lipid metabolism to assess the contribution of altered lipid homeostasis to observed phenotypes.

Comparative systems approach:

  • Parallel analysis of different V-ATPase assembly factor deficiencies to identify common versus unique phenotypes.

  • Cross-species comparison of VMA21 disruption in various model systems.

  • Cell-type specific analysis to identify context-dependent versus universal effects of VMA21 disruption.

Direct target identification:

  • Proximity labeling to identify immediate molecular neighbors of VMA21.

  • Rapid immunoprecipitation after crosslinking to capture direct physical interactions.

  • Correlation analysis between VMA21 protein levels and severity of various phenotypes.

This multi-faceted approach enables researchers to construct causality maps linking VMA21 function directly to specific cellular processes versus those arising as secondary consequences of primary defects.

What are the most sensitive biomarkers for monitoring VMA21 dysfunction in experimental systems?

Identifying sensitive biomarkers for VMA21 dysfunction enables precise monitoring in experimental systems. The most reliable indicators span multiple cellular processes:

V-ATPase assembly and function markers:

  • Reduced V₀ domain subunit levels (ATP6V0D1, ATP6V0C) detected by western blotting, with typically 40-60% reduction observed in patient fibroblasts .

  • Decreased LysoSensor or LysoTracker fluorescence intensity, providing a direct readout of impaired acidification .

  • Altered subcellular distribution of V-ATPase components detected by immunofluorescence.

Autophagy pathway indicators:

  • Increased LC3-II/LC3-I ratio reflecting autophagosome accumulation.

  • Elevated p62/SQSTM1 levels indicating impaired autophagic degradation.

  • Accumulation of lipid droplet-containing autolysosomes, particularly evident in hepatocytes .

  • Ultrastructural evidence of enlarged autolysosomes visible by electron microscopy.

Glycosylation abnormalities:

  • Altered transferrin glycoform patterns detectable by isoelectric focusing.

  • Changed N-glycan profiles measurable by mass spectrometry.

  • Abnormal ApoCIII glycosylation patterns identifiable by isoelectric focusing .

Metabolic alterations:

  • Elevated cholesterol levels, particularly LDL cholesterol.

  • Increased activation of SREBP-mediated cholesterol synthesis pathways .

  • Altered amino acid profiles in cellular extracts due to impaired protein degradation .

ER stress markers:

  • Increased BiP/GRP78 expression.

  • XBP1 splicing activation.

  • Elevated CHOP expression.

Table 3: Sensitivity and Specificity of VMA21 Dysfunction Biomarkers

BiomarkerDetection MethodSensitivitySpecificity for VMA21 vs. Other V-ATPase DefectsTime to Detection After VMA21 Disruption
V₀ subunit levelsWestern blotHighModerate24-48 hours
Lysosomal pHLysoSensorVery highLow12-24 hours
LC3-II/LC3-I ratioWestern blotHighLow24-48 hours
Lipid droplets in autolysosomesElectron microscopyModerateHigh48-72 hours
Transferrin glycoformsMass spectrometryHighHigh72+ hours
SREBP activationNuclear translocationModerateHigh48-72 hours
BiP/GRP78 expressionqPCR/Western blotHighLow6-24 hours

These biomarkers provide comprehensive monitoring of VMA21 dysfunction across multiple cellular processes, with selection based on experimental requirements for sensitivity, specificity, and temporal resolution.

What therapeutic strategies targeting VMA21 dysfunction show the most promise?

Research into therapeutic approaches for VMA21 dysfunction has identified several promising strategies that could be evaluated using Xenopus tropicalis models:

Gene replacement and correction approaches:

  • AAV-mediated gene delivery of functional VMA21, which holds particular promise due to the small size of the VMA21 gene fitting well within AAV packaging limits.

  • mRNA therapeutics delivering wild-type VMA21 transcripts to bypass transcriptional defects.

  • CRISPR-based gene editing to correct specific mutations, potentially using base editing for point mutations like p.Asn63Gly or p.Gly91Ala .

Small molecule modulators:

  • V-ATPase assembly enhancers identified through high-throughput screening.

  • Chemical chaperones to stabilize mutant VMA21 protein, particularly relevant for missense mutations.

  • Compounds that enhance residual V-ATPase activity in hypomorphic mutations.

Pathway-specific interventions:

  • Autophagy modulators, with ULK1 inhibitors showing particular promise in VMA21-mutated follicular lymphoma cells .

  • ER stress alleviators to mitigate cellular consequences of misfolded proteins.

  • Cholesterol-lowering agents to address hypercholesterolemia associated with VMA21-CDG .

Lysosomal function restoration:

  • Alternative approaches to acidify lysosomes independent of V-ATPase function.

  • Enhancement of residual lysosomal enzyme activity through pharmacological chaperones.

  • Promotion of alternative degradation pathways to compensate for impaired autophagy.

Disease-specific approaches:

  • For VMA21-CDG: glycosylation enhancers and metabolic modulators targeting hepatic manifestations.

  • For VMA21-XMEA: muscle-targeted therapies enhancing protein turnover and organelle quality control.

  • For VMA21-associated lymphoma: selective autophagy inhibitors exploiting the dependency created by VMA21 mutation .

Table 4: Comparative Analysis of Therapeutic Approaches for VMA21 Dysfunction

Therapeutic ApproachMechanismDevelopment StageAdvantagesChallenges
AAV-VMA21 gene therapyGene replacementPreclinicalOne-time treatment potentialTissue targeting, immune responses
mRNA therapeuticsTransient gene supplementationEarly researchAvoids genomic integrationRequires repeated administration
ULK1 inhibitorsAutophagy inhibitionPreclinical (lymphoma)Exploits synthetic lethalityMay affect normal tissues
Chemical chaperonesProtein stabilizationEarly researchOral bioavailability potentialMutation-specific efficacy
Cholesterol-lowering drugsSymptom managementAvailable clinicallyImmediate availabilityAddresses secondary effects only
CRISPR gene editingMutation correctionEarly researchPermanent correction potentialDelivery challenges, off-target risks

The Xenopus tropicalis model offers an ideal platform for rapid screening and validation of these approaches before transition to mammalian models and clinical development.

How can researchers design high-throughput screens for modulators of VMA21 function?

Designing effective high-throughput screens for VMA21 modulators requires careful selection of cellular readouts and screening platforms:

Primary screening assays:

  • Lysosomal acidification reporters using pH-sensitive fluorescent proteins or dyes in VMA21-deficient cells.

  • V-ATPase assembly monitoring using split fluorescent protein tags on V₁ and V₀ components.

  • Reporter gene constructs driven by CLEAR network transcription factors (TFEB, TFE3) that respond to lysosomal dysfunction.

  • Fluorescent substrate degradation assays measuring lysosomal proteolytic activity.

  • Autophagy reporters detecting autophagic flux or autophagosome accumulation.

Cell-based screening systems:

  • Stable cell lines with VMA21 mutations corresponding to human disease variants.

  • Inducible VMA21 knockdown systems for controlled modulation of expression.

  • Xenopus primary cell cultures from VMA21-mutant animals.

  • Human patient-derived fibroblasts or iPSCs with VMA21 mutations.

Screen optimization strategies:

  • Z'-factor optimization to ensure statistical robustness.

  • Inclusion of positive controls (V-ATPase inhibitors, known autophagy modulators).

  • Development of counter-screens to eliminate false positives and cytotoxic compounds.

  • Dose-response profiling to establish potency and therapeutic window.

Advanced screening approaches:

  • Phenotypic screening in Xenopus embryos with fluorescent readouts of V-ATPase-dependent processes.

  • CRISPR-based genetic modifier screens to identify synthetic lethal or synthetic rescue interactions.

  • Fragment-based screening against purified VMA21 to identify direct binding molecules.

  • In silico screening against predicted binding pockets in VMA21 structure models.

Validation pipeline:

  • Secondary assays confirming target engagement and mechanism of action.

  • Orthogonal assays verifying functional restoration of V-ATPase activity.

  • Testing in multiple cell types to assess context-dependency.

  • Evaluation in Xenopus embryos to assess in vivo efficacy and toxicity.

Table 5: Comparative Analysis of High-Throughput Screening Approaches for VMA21 Modulators

Screening ApproachReadoutThroughput CapacityAdvantagesLimitations
LysoSensor intensityFluorescence>100,000 compounds/weekDirect measurement of acidificationPotential fluorescence interference
V-ATPase assembly (BiFC)Fluorescence10,000-50,000 compounds/weekDirect assessment of assemblyPotential false positives from protein stabilizers
TFEB nuclear translocationImage-based5,000-20,000 compounds/weekCaptures physiological responseIndirect readout of VMA21 function
Autophagic fluxDual fluorescence1,000-10,000 compounds/weekFunctional consequence measurementComplex analysis, requires image processing
Xenopus embryo phenotypeVisual assessment100-1,000 compounds/weekIn vivo relevanceLower throughput, complex phenotypes

These approaches provide a comprehensive strategy for identifying compounds that could modulate VMA21 function for therapeutic benefit across multiple disease contexts.

What considerations are important when translating findings from Xenopus tropicalis VMA21 research to human applications?

Translating findings from Xenopus tropicalis VMA21 research to human applications requires careful consideration of several key factors:

Species-specific differences:

  • Protein sequence divergence between Xenopus and human VMA21 may affect drug binding sites and protein-protein interactions.

  • Differences in tissue expression patterns and developmental timing may limit direct extrapolation of certain phenotypes.

  • Metabolism and pharmacokinetics differ significantly between amphibians and mammals, requiring adjustment in dosing and drug design.

  • Cellular context variations may affect the consequences of VMA21 dysfunction in specific tissues.

Physiological considerations:

  • Temperature sensitivity of certain phenotypes or interventions may differ between poikilothermic amphibians and homeothermic humans.

  • Developmental processes in Xenopus may not have direct human counterparts.

  • Compensatory mechanisms may vary between species, affecting the long-term consequences of therapeutic interventions.

Experimental model validation:

  • Confirmation of key findings in mammalian models before human translation.

  • Validation in patient-derived cells (fibroblasts, iPSCs, organoids) to confirm relevance to human disease.

  • Comparison of phenotypes between Xenopus models and clinical manifestations in human patients.

  • Assessment of cross-species conservation of critical pathways and molecular interactions.

Therapeutic development pathway:

  • Pharmacodynamic biomarker identification for monitoring treatment effects that translate between species.

  • Consideration of route of administration appropriate for the human context.

  • Assessment of safety margins with particular attention to species differences in susceptibility.

  • Development of human-optimized versions of therapeutic entities (humanized antibodies, codon-optimized gene constructs).

Regulatory and ethical considerations:

  • Determination of appropriate safety studies bridging from amphibian to human applications.

  • Design of clinically feasible endpoints that correspond to preclinical measures.

  • Development of companion diagnostics for patient stratification based on molecular findings.

  • Consideration of genetic testing implications for X-linked disorders caused by VMA21 mutations.

This thoughtful translation process maximizes the value of Xenopus tropicalis as a model system while acknowledging its limitations, ultimately accelerating the development of effective interventions for human VMA21-associated disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.