Recombinant Xenopus tropicalis Vang-like protein 2 (vangl2)

Shipped with Ice Packs
In Stock

Description

Introduction to Vang-like protein 2

Vang-like protein 2 (vangl2) is a core component of the planar cell polarity pathway, originally identified through studies of its Drosophila homolog, Van Gogh. In vertebrates, vangl2 plays critical roles in coordinating cell movements and orientation during development, particularly in processes such as neural tube closure and convergent extension movements during gastrulation . The protein belongs to a small family that includes vangl1, with which it shares significant sequence homology and some functional redundancy.

In Xenopus species, vangl2 has been extensively studied due to the advantages this model system offers for investigating early developmental processes. Maternal vangl2 is present in Xenopus oocytes and early embryos, contributing to establishing essential polarities required for proper embryonic patterning . Significantly, disruption of vangl2 function leads to developmental abnormalities, highlighting its essential role in vertebrate embryogenesis.

General Structure

Vangl2 is a multi-pass transmembrane protein with cytoplasmic N-terminal and C-terminal domains. The C-terminal region contains critical motifs for protein-protein interactions, including PDZ-binding motifs that mediate interactions with other PCP components . The protein's structure is highly conserved across vertebrate species, reflecting its fundamental developmental role.

Critical mutations in vangl2 have been identified in the C-terminal cytoplasmic region, which in mouse models result in severe neural tube defects . These mutations typically affect protein stability and localization, with mutant vangl2 being retained in the endoplasmic reticulum and subsequently degraded by the proteasome .

Identification of Multiple Isoforms

Recent research has revealed the existence of multiple vangl2 isoforms in vertebrates, including Xenopus. Most notably, an N-terminally extended isoform termed "vangl2-Long" has been identified . This longer isoform arises from alternative translation initiation at a near-cognate AUA start codon upstream of the coding region for canonical vangl2 .

The sequence encoding this N-terminal extension shows strong conservation among vertebrate genomes, suggesting functional significance. In Xenopus laevis, both canonical vangl2 and vangl2-Long are expressed during embryogenesis, with distinct temporal patterns . Mass spectrometry analysis of proteins immunoprecipitated from gastrula stage Xenopus embryos has confirmed the presence of peptides corresponding to both isoforms .

Table 1: Comparison of vangl2 Isoforms in Xenopus

FeatureCanonical vangl2vangl2-Long
Translation initiationStandard AUG codonAlternative near-cognate AUA codon upstream
N-terminal extensionAbsentPresent, conserved among vertebrates
Approximate molecular weight~62 kD~70 kD
Temporal expressionHigh from gastrulation through organogenesisDeclines after tailbud stage 25
Developmental requirementEssential for PCPRequired for embryo extension and neural tube closure
Antibody detectionDetected by monoclonal antibody 36E3Detected by monoclonal antibody 36E3

Developmental Expression Patterns

Both vangl2 isoforms show distinct temporal expression patterns during Xenopus development. They are detectable from the earliest stages of embryogenesis (cleavage stages), presumably from maternal origin . Expression increases at midblastula transition (stages 8-9) and reaches peak levels during gastrulation and neurulation .

While canonical vangl2 remains highly expressed from gastrulation through organogenesis, vangl2-Long shows a significant decline after tailbud stage 25 . This differential expression pattern suggests distinct developmental roles for the two isoforms and indicates precise developmental regulation of alternative translation initiation.

Functions in Planar Cell Polarity

In Xenopus, vangl2 functions as a core component of the PCP pathway, coordinating cell polarization within epithelial tissues. Studies using antisense morpholino oligonucleotides specifically designed to knockdown vangl2-Long in Xenopus have demonstrated that this isoform is functional and required for embryo extension and neural tube closure .

Both vangl2 and vangl2-Long must be correctly expressed for the polarized distribution of other PCP molecules, including Prickle 2 (Pk2) and Dishevelled 1 (Dvl1) . Additionally, proper vangl2 expression is necessary for centriole rotational polarity in ciliated epidermal cells . These findings suggest that vangl2 contributes significantly to the establishment and maintenance of planar cell polarity in vertebrate tissues.

Maternal vangl2 in Oocytes

Studies of Xenopus oocytes have revealed unexpected roles for maternal vangl2. Rather than localizing primarily to the plasma membrane as initially assumed, vangl2 is distributed in animally enriched islands in the subcortical cytoplasm of full-grown oocytes .

In this location, vangl2 interacts with a post-Golgi v-SNARE protein called VAMP1 and with acetylated microtubules . These interactions appear functionally significant, as vangl2 is required for VAMP1 stability and for maintaining the stable microtubule architecture of the oocyte . Depletion of vangl2 leads to a loss of VAMP1 protein from the oocyte, suggesting that vangl2 is not merely cargo in these vesicles but plays a role in their maintenance .

Interaction with Apical-Basal Polarity Components

Xenopus vangl2 interacts with atypical protein kinase C (aPKC), a key component of the apical-basal polarity pathway . This interaction is particularly significant as it represents a point of crosstalk between the planar cell polarity and apical-basal polarity systems.

Both the acetylated microtubule cytoskeleton and the vangl2-VAMP1 distribution in Xenopus oocytes depend on the presence of aPKC . Furthermore, both aPKC and vangl2 are required for the cell membrane asymmetry established during oocyte maturation and for the asymmetrical distribution of maternal transcripts for germ layer and dorsal/ventral determinants VegT and Wnt11 .

Table 2: Key Interaction Partners of Xenopus vangl2

Interaction PartnerType of ProteinFunctional Significance
VAMP1Post-Golgi v-SNAREVesicle trafficking, VAMP1 stability, possible regulation of protein secretion
aPKCSerine/threonine kinaseMicrotubule cytoskeleton stability, asymmetric distribution of maternal transcripts
Prickle 2 (Pk2)PCP core proteinAsymmetric distribution, planar cell polarity establishment
Dishevelled 1 (Dvl1)PCP core proteinAsymmetric distribution, planar cell polarity signaling
vangl1PCP core proteinForms multimeric complex, possible functional redundancy

Role in Embryonic Patterning

Depletion of maternal vangl2 in Xenopus oocytes leads to defects in embryonic patterning that differ from those observed when vangl2 function is disrupted after fertilization . This suggests that maternal vangl2 has distinct roles from zygotic vangl2, particularly in establishing early asymmetries essential for proper development.

When maternal vangl2 is depleted using antisense oligonucleotides injected into oocytes, embryos exhibit ventralization phenotypes . In contrast, disruption of vangl2 function after fertilization typically leads to convergence-extension defects and open neural folds . This difference likely reflects the importance of maternal vangl2 in establishing the initial distributions of key developmental determinants.

Expression Systems

Recombinant vangl2 can be expressed and purified using various host systems, each with distinct advantages for different research applications . The choice of expression system significantly impacts protein yield, post-translational modifications, and functional characteristics.

Table 3: Expression Systems for Recombinant vangl2 Production

Expression SystemAdvantagesLimitationsPost-translational Modifications
E. coliHigh yield, short turnaround time, cost-effectiveLimited post-translational modificationsMinimal
YeastGood yield, some eukaryotic modificationsMore complex than bacterial systemsModerate
Insect cells (baculovirus)Many necessary post-translational modificationsLower yield, longer production timeExtensive
Mammalian cellsMost authentic protein folding and modificationsLowest yield, highest costMost complete

Purification Challenges

As a multi-pass transmembrane protein, vangl2 presents significant challenges for recombinant expression and purification. These challenges include proper membrane insertion, correct folding, and the need for detergent solubilization during purification. Various approaches have been developed to address these issues, including the use of fusion tags to enhance solubility and facilitate purification.

Common purification strategies include affinity chromatography using tags such as polyhistidine (His-tag), glutathione S-transferase (GST), or maltose-binding protein (MBP). These tags enable selective binding to appropriate resins, allowing separation of the target protein from host cell proteins. Following initial purification, additional chromatography steps may be employed to achieve higher purity.

Quality Assessment

Quality assessment of recombinant vangl2 typically involves multiple analytical methods to confirm identity, purity, and functional integrity. These may include:

  1. SDS-PAGE and western blotting to verify protein size and immunoreactivity

  2. Mass spectrometry to confirm protein identity and detect post-translational modifications

  3. Circular dichroism spectroscopy to assess secondary structure

  4. Functional assays to evaluate biological activity

For recombinant Xenopus tropicalis vangl2, validation often includes testing its ability to interact with known binding partners such as VAMP1 or aPKC, using techniques such as co-immunoprecipitation or pull-down assays.

Functional Assays

Recombinant vangl2 proteins enable a variety of functional assays to investigate their effects on cellular processes. These assays can reveal how vangl2 influences microtubule stability, vesicle trafficking, or the localization of other polarity proteins.

In Xenopus oocytes and embryos, microinjection of recombinant proteins offers an approach complementary to genetic manipulations. This technique can be particularly valuable for structure-function analyses, where specific domains or mutant forms of the protein are introduced to assess their effects on development.

Interaction Studies

One of the most important applications of recombinant vangl2 is in studying its interactions with other proteins. Biochemical approaches such as co-immunoprecipitation, pull-down assays, and surface plasmon resonance can characterize the specificity, affinity, and dynamics of these interactions.

Studies have shown that vangl2 belongs to a multimeric complex with vangl1 and other vangl2 molecules . Additionally, the identification of interactions with VAMP1 and aPKC has revealed unexpected connections between the planar cell polarity pathway and vesicle trafficking machinery . These findings highlight the complex integration of different cellular processes during development.

Antibody Development

Recombinant Xenopus tropicalis vangl2 serves as an important antigen for developing specific antibodies. These antibodies are essential tools for studying the expression, localization, and function of endogenous vangl2 in developmental contexts.

The development of monoclonal antibody 36E3, which recognizes both isoforms of vangl2 but not vangl1, has been particularly valuable for studies in Xenopus . Such reagents enable visualization of protein distribution by immunostaining and quantification by western blotting, providing insights into the dynamic regulation of vangl2 during development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vangl2; stbm; Vang-like protein 2; Protein strabismus; Van Gogh-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
Target Protein Sequence
MDNDSQYSGYSYKSGHSRSSRKHRDRRERHRSKSREGSRGDKSVTIQAPGEPLLDNESTR GEDRDDNWGETTTVVTGTSEHSISHDDITRITKDMEDSAKLDCSRHLGVVIGGALALLSF LTPIAFMLLPQILWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFV FRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELR QLQPQFTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK KMSGFKVYSLGEENTTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLV VAVEEAFTHIKRLQDEDQKNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LHHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVL KRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV
Uniprot No.

Target Background

Function
Involved in non-canonical Wnt/planar cell polarity (PCP) signaling, Vangl2 recruits Dishevelled (Dvl) and Prickle from the cytoplasm to the plasma membrane. As a component of the PCP complex, it regulates the polarized assembly of fibronectin on the mesoderm surface during gastrulation. It regulates convergent extension in both dorsal mesoderm and neural tissue without affecting cell fate and is essential for neural fold closure during neurulation. Vangl2 may also be required for the cell surface localization of Frizzled 3 (Fzd3) and Frizzled 6 (Fzd6) in the inner ear.
Database Links
Protein Families
Vang family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Vangl2 in Xenopus development?

Vangl2 (Vang-like protein 2) is a core component of the planar cell polarity (PCP) pathway in vertebrates, including Xenopus species. In Xenopus embryogenesis, Vangl2 is critically involved in convergent extension (CE) movements during gastrulation and neurulation stages. When Vangl2 is depleted in Xenopus, severe developmental defects occur, including a significant reduction in body length and incomplete neural tube closure . These phenotypes highlight Vangl2's essential role in coordinating polarized cell movements.

The function of Vangl2 extends beyond early embryogenesis. Maternal Vangl2 is present from the earliest stages of development, detectable at cleavage stages, and its expression increases significantly during midblastula transition (stages 8-9), reaching peak levels during gastrulation and neurulation . This expression pattern suggests that Vangl2 has distinct temporal roles throughout development.

In the Xenopus oocyte, Vangl2 demonstrates a unique subcellular distribution pattern, being concentrated in animally enriched islands in the subcortical cytoplasm rather than at the plasma membrane . This localization pattern suggests specialized functions in oocyte organization prior to fertilization.

What are the known isoforms of Xenopus Vangl2?

Recent research has identified two main isoforms of Vangl2 in Xenopus: the canonical Vangl2 and an N-terminally extended isoform called Vangl2-Long . Vangl2-Long arises from alternative translation initiation at a near-cognate AUA start codon upstream of the coding region of canonical Vangl2. This N-terminal extension is strongly conserved among vertebrate genomes, suggesting functional importance.

Both isoforms are detectable from the earliest stages of embryogenesis in Xenopus, with distinct developmental expression patterns. While canonical Vangl2 remains highly expressed from gastrulation through organogenesis, Vangl2-Long shows a significant decline in expression levels from tail bud stage 25 . This differential regulation indicates that the two isoforms may serve complementary or specialized functions at different developmental stages.

Experimental evidence demonstrates that both Vangl2 and Vangl2-Long must be correctly expressed for proper polarized distribution of other PCP molecules, such as Pk2 and Dvl1, and for centriole rotational polarity in ciliated epidermal cells .

What phenotypes result from Vangl2 disruption in Xenopus?

Disruption of Vangl2 function in Xenopus embryos results in several characteristic phenotypes that reflect its crucial role in planar cell polarity and developmental processes:

Neural tube defects (NTDs) are among the most prominent phenotypes observed when Vangl2 function is compromised. In Xenopus, depletion of Vangl2 leads to incomplete neural tube closure, similar to the craniorachischisis observed in mouse Vangl2 mutants . These defects result from disrupted convergent extension movements during neurulation.

Body length reduction is another significant phenotype associated with Vangl2 depletion in Xenopus. The embryos display a severe shortening of the anterior-posterior axis due to defective convergent extension during gastrulation . This phenotype underscores Vangl2's role in coordinating the polarized cell movements necessary for proper axis elongation.

At the cellular level, Vangl2 disruption affects the polarized distribution of other PCP proteins and disrupts centriole rotational polarity in multiciliated cells (MCCs) . These cellular defects highlight Vangl2's function in establishing and maintaining planar polarity across tissues.

When maternal Vangl2 is depleted in the oocyte, additional defects emerge, including disruption of stable microtubule architecture, abnormal distribution of maternal determinants (VegT and Wnt11), and compromised membrane asymmetry during oocyte maturation .

How does Vangl2-Long contribute to PCP signaling differently than canonical Vangl2?

Vangl2-Long represents a recently identified extended isoform of Vangl2 that contains an N-terminal extension conserved across vertebrate species . Research suggests that Vangl2-Long makes distinct contributions to planar cell polarity (PCP) signaling compared to canonical Vangl2, though both proteins function within the same pathway.

Functional studies using morpholino oligonucleotides to specifically knockdown Vangl2-Long in Xenopus have demonstrated that this isoform is not merely redundant with canonical Vangl2 but has specific functional requirements. Both Vangl2 and Vangl2-Long must be correctly expressed to maintain proper PCP in vertebrate tissues . When Vangl2-Long is selectively depleted, embryos exhibit typical PCP phenotypes despite the presence of canonical Vangl2, indicating non-redundant functions.

At the molecular level, Vangl2-Long appears to significantly contribute to the pool of Vangl2 molecules present at the plasma membrane . This suggests that Vangl2-Long may have specific membrane trafficking or stability properties that differ from canonical Vangl2. The precise mechanisms by which Vangl2-Long exerts its functions, particularly how its N-terminal extension modifies protein-protein interactions or subcellular localization, remains an active area of investigation.

The temporal regulation of Vangl2-Long expression differs from that of canonical Vangl2, with Vangl2-Long showing a significant decline from tail bud stage 25, while canonical Vangl2 remains highly expressed . This differential expression pattern suggests stage-specific roles for each isoform during development.

What protein interactions does Vangl2 form in Xenopus developmental contexts?

Vangl2 participates in multiple protein-protein interactions that are critical for its function in planar cell polarity and developmental processes in Xenopus:

Vangl2 forms multimeric complexes with its paralog Vangl1. Co-immunoprecipitation experiments have confirmed that both canonical Vangl2 and Vangl2-Long physically interact with Vangl1 . This interaction occurs independently of endogenous Vangl2, suggesting direct binding between these proteins. The Vangl1-Vangl2 interaction is likely important for establishing proper PCP signaling, as these proteins have been shown to interact both genetically and physically.

In Xenopus oocytes, Vangl2 interacts with VAMP1, a post-Golgi v-SNARE protein involved in vesicular trafficking . This interaction is particularly interesting as it connects Vangl2 to the vesicle trafficking system. Vangl2 appears to be required for the stability of VAMP1, as depletion of Vangl2 leads to reduced VAMP1 levels.

Another significant interaction partner for Vangl2 is atypical protein kinase C (aPKC), a component of the apical-basal polarity pathway . This interaction is notable because it represents a point of crosstalk between the PCP and apical-basal polarity pathways. The Vangl2-aPKC interaction appears functionally important, as depletion of either protein results in similar phenotypes affecting embryonic patterning.

Vangl2 also interacts with acetylated microtubules in the oocyte . This interaction connects Vangl2 to the cytoskeletal infrastructure and may be important for maintaining proper microtubule architecture, as Vangl2 depletion leads to disruption of the stable microtubule network.

What are the optimal methods for expressing recombinant Xenopus tropicalis Vangl2 in vitro?

Expressing recombinant Xenopus tropicalis Vangl2 in vitro requires careful consideration of several factors to ensure proper protein folding, post-translational modifications, and functional activity. Based on research protocols, the following approaches have proven successful:

Expression system selection is critical for Vangl2, as it is a multi-pass transmembrane protein with complex folding requirements. Mammalian expression systems such as HEK 293T cells have been successfully used for expressing Xenopus Vangl2 . These systems provide the appropriate cellular machinery for proper folding and post-translational modifications of membrane proteins.

For construct design, it's important to consider whether to express canonical Vangl2 or Vangl2-Long, as they may have different functional properties. When expressing Vangl2-Long, the construct should include the upstream near-cognate AUA start codon and its surrounding sequence context to allow for alternative translation initiation . For detection and purification purposes, epitope tags can be added, though care should be taken regarding their placement to avoid interfering with protein function.

Regarding purification strategies, it's worth noting that overexpressed Vangl2 in oocytes localizes differently than endogenous Vangl2 . While endogenous Vangl2 is found in subcortical cytoplasmic islands, overexpressed Vangl2 tends to accumulate at the cell membrane. This suggests that cellular processing of recombinant Vangl2 may differ from endogenous protein, which could affect functional studies.

For functional assays, co-immunoprecipitation experiments can be used to verify proper protein-protein interactions, such as those with Vangl1 or aPKC . Additionally, rescue experiments in Vangl2-depleted embryos or cells can confirm the functionality of the recombinant protein, though previous research has noted challenges in rescuing certain Vangl2-depleted phenotypes with injected mRNA .

How can researchers specifically target Vangl2-Long without affecting canonical Vangl2 expression?

Morpholino oligonucleotides (MOs) offer a precise approach for inhibiting Vangl2-Long translation. Research has demonstrated that MOs designed to specifically target the alternative translation initiation site of Vangl2-Long effectively knock down this isoform without significantly affecting canonical Vangl2 expression . These MOs are typically designed to bind the region containing the near-cognate AUA start codon that initiates Vangl2-Long translation.

The effectiveness of this approach can be verified through Western blot analysis, which should show reduced expression of the higher molecular weight Vangl2-Long band while the canonical Vangl2 band remains relatively unchanged . This differential targeting is possible because the two isoforms utilize different translation initiation sites.

When assessing the effects of Vangl2-Long-specific knockdown, researchers should examine classic PCP phenotypes, including neural tube closure defects, convergent extension abnormalities, and disruptions in the polarized distribution of PCP components like Pk2 and Dvl1 . These assays can confirm the functional specificity of the targeting approach.

What are the most effective methods for studying Vangl2 function in Xenopus embryos?

Investigating Vangl2 function in Xenopus embryos requires a combination of molecular, cellular, and developmental approaches. The following methodologies have proven particularly effective:

Gain-of-function experiments using mRNA injection allow for overexpression of Vangl2, though with important caveats. Research has shown that overexpressed Vangl2 in oocytes does not co-distribute with endogenous Vangl2 and might interfere with endogenous protein function . This observation highlights the importance of complementary approaches and appropriate controls when interpreting overexpression results.

For phenotypic analysis, researchers should examine convergent extension movements, neural tube closure, and body axis elongation, as these developmental processes are particularly sensitive to Vangl2 disruption . Quantitative measurements of embryo length, neural fold distance, and tissue morphology provide objective assessments of phenotypic severity.

At the cellular level, immunofluorescence analysis of PCP protein localization (such as Pk2 and Dvl1) and examination of centriole rotational polarity in multiciliated cells offer sensitive readouts of PCP disruption . These cellular phenotypes often precede and underlie the macroscopic developmental defects.

What controls should be included when performing Vangl2 knockdown experiments?

Designing robust controls for Vangl2 knockdown experiments is essential for ensuring experimental validity and accurate interpretation of results:

Standard control morpholinos or oligonucleotides with similar chemical properties but lacking specific targets should be included to control for potential non-specific effects of the delivery method . These controls help distinguish between specific Vangl2-related phenotypes and general effects of the experimental manipulation.

Isoform-specific controls are essential when targeting particular Vangl2 variants. When knocking down Vangl2-Long, researchers should verify that canonical Vangl2 expression remains intact, typically through Western blot analysis showing selective reduction of the higher molecular weight band corresponding to Vangl2-Long .

Phenotypic specificity controls involve comparing observed phenotypes with established PCP defects. True Vangl2 disruption should produce characteristic phenotypes, including neural tube closure defects, shortened body axis, and disrupted polarized distribution of PCP components . Absence of these hallmark phenotypes might indicate insufficient knockdown or non-specific effects.

How can researchers analyze Vangl2 protein localization and distribution in Xenopus tissues?

Accurate analysis of Vangl2 localization in Xenopus tissues requires careful consideration of fixation, detection methods, and appropriate controls:

When studying specific Vangl2 isoforms, antibody selection is crucial. For distinguishing between canonical Vangl2 and Vangl2-Long, antibodies recognizing the N-terminal extension of Vangl2-Long (such as pAb N-VGL2) can be used alongside pan-Vangl2 antibodies (such as mAb 36E3) . This dual-antibody approach enables comparative analysis of isoform-specific localization patterns.

For quantitative analysis of Vangl2 localization, methods such as line scan analysis across cell boundaries, polarity vector calculations, or fluorescence intensity measurements at specific cellular domains can provide objective metrics of protein distribution. These quantitative approaches are particularly valuable when assessing subtle changes in protein asymmetry or comparing different experimental conditions.

Co-localization studies with other PCP components (such as Pk2, Dvl1) or cellular structures (such as VAMP1-positive vesicles, acetylated microtubules) provide contextual information about Vangl2 function . These studies can reveal functional interactions and dependencies between Vangl2 and other cellular components.

Controls for antibody specificity are essential, particularly verification of signal loss in Vangl2-depleted samples . Additionally, comparison with tagged Vangl2 constructs can help validate antibody performance, though researchers should be aware that overexpressed tagged proteins might not precisely mimic endogenous localization patterns.

How do researchers distinguish between direct and indirect effects of Vangl2 manipulation?

Distinguishing direct from indirect effects of Vangl2 manipulation requires multiple complementary approaches and careful experimental design:

Timing analysis provides valuable insights, as direct effects typically manifest earlier than secondary consequences. By examining phenotypes at multiple developmental stages following Vangl2 disruption, researchers can establish a temporal sequence of events. For example, changes in PCP protein localization often precede macroscopic developmental defects, suggesting they represent more direct consequences of Vangl2 manipulation .

Biochemical interaction studies, such as co-immunoprecipitation experiments, can identify direct binding partners of Vangl2. Research has established direct interactions between Vangl2 and several proteins, including Vangl1, VAMP1, and aPKC . These physical interactions suggest pathways that might be directly affected by Vangl2 manipulation.

Domain-specific mutations or truncations can help pinpoint regions of Vangl2 required for specific functions or interactions. By comparing phenotypes resulting from these targeted manipulations with those observed after complete Vangl2 depletion, researchers can delineate direct functional relationships.

Rescue experiments with varying timing can help establish causal relationships. If a phenotype can be rescued by restoring Vangl2 expression before, but not after, a certain developmental stage, this suggests a direct requirement for Vangl2 during that critical period.

Epistasis analysis, examining the effects of manipulating Vangl2 in the context of altered expression of other genes, can reveal pathway relationships. For instance, the similar phenotypes observed after Vangl2 or aPKC depletion, together with their physical interaction, suggest they function in a common pathway .

How should contradictory results in Vangl2 research be reconciled?

When faced with contradictory results in Vangl2 research, several systematic approaches can help reconcile discrepancies:

Isoform-specific effects represent an important consideration. The discovery of Vangl2-Long highlights how different Vangl2 isoforms might have distinct functions or be differentially affected by experimental manipulations . Researchers should clearly specify which Vangl2 isoforms are being studied and consider whether isoform differences might explain contradictory results.

Developmental timing significantly impacts Vangl2 function and experimental outcomes. For example, morpholino injections after fertilization might not affect maternal Vangl2 functions in oocyte organization, resulting in phenotypes that differ from those observed after maternal depletion . Careful comparison of experimental timelines can help explain apparently conflicting results.

Experimental approach differences can lead to divergent findings. For instance, studies have noted that overexpressed Vangl2 localizes differently than endogenous protein and might act as a dominant negative . Therefore, loss-of-function and gain-of-function studies might yield seemingly contradictory results despite targeting the same protein.

Context-dependent functions of Vangl2 across different tissues or developmental stages might explain varying experimental outcomes. Vangl2's interactions with other proteins and its functional requirements might differ between contexts, leading to apparently inconsistent results when studied in different systems.

Technical considerations, including antibody specificity, knockdown efficiency, and phenotypic scoring criteria, can contribute to contradictory findings. Standardized protocols and rigorous control experiments are essential for meaningful cross-study comparisons.

What are the current gaps in understanding Vangl2 function in Xenopus development?

Despite significant advances, several important gaps remain in our understanding of Vangl2 function in Xenopus development:

The precise mechanism of Vangl2-Long translation initiation requires further investigation. While this isoform arises from alternative translation starting at a near-cognate AUA codon , the regulatory factors controlling this process and potentially modulating the ratio between canonical Vangl2 and Vangl2-Long remain unknown.

The functional significance of Vangl2's interaction with VAMP1 and vesicular trafficking requires clarification. Although Vangl2 co-localizes with and stabilizes VAMP1 in Xenopus oocytes , the broader implications of this interaction for membrane trafficking during development are not fully understood.

The relationship between maternal and zygotic Vangl2 functions needs further exploration. Maternal Vangl2 plays critical roles in oocyte organization and early embryonic patterning , but how these functions relate to and potentially influence later zygotic Vangl2 activities remains incompletely characterized.

The molecular mechanisms underlying cross-talk between the PCP and apical-basal polarity pathways, particularly through the Vangl2-aPKC interaction , represent an important area for future research. Understanding how these two fundamental polarity systems are integrated during development could provide insights into complex morphogenetic processes.

The tissue-specific requirements for different Vangl2 isoforms and their potential compensatory relationships warrant further investigation. While both Vangl2 and Vangl2-Long are required for proper PCP , the relative contribution of each isoform might vary across tissues and developmental contexts.

How can Xenopus Vangl2 research inform understanding of human neural tube defects?

Research on Xenopus Vangl2 provides valuable insights into human neural tube defects (NTDs) through several parallel mechanisms and findings:

Genetic conservation between Xenopus and human VANGL2 underlies the translational relevance of this research. Notably, the sequence encoding the N-terminal extension of Vangl2-Long is strongly conserved among vertebrate genomes, including humans . This conservation suggests functional importance and potential relevance to human development and disease.

Human VANGL2 mutations have been identified in both familial and sporadic cases of neural tube defects . Xenopus models allow functional testing of these variants through rescue experiments, where human VANGL2 variants can be expressed in Vangl2-depleted Xenopus embryos to assess their ability to restore normal development.

Mechanistic insights from Xenopus research have elucidated how Vangl2 disruption leads to neural tube defects. Studies have demonstrated that both Vangl2 isoforms are required for proper polarized distribution of PCP molecules and for convergent extension movements during neurulation . These mechanisms are likely conserved in human neural tube closure.

The identification of Vangl2 interaction partners in Xenopus, including Vangl1, aPKC, and VAMP1 , provides candidate genes for human genetic studies. Mutations in genes encoding these interaction partners might contribute to NTDs, particularly in cases where VANGL2 mutations have been excluded.

Xenopus models facilitate screening of environmental factors and therapeutic interventions that might modify the penetrance or expressivity of Vangl2-related neural tube defects. The rapid development and external fertilization of Xenopus embryos make them ideal for testing potential protective factors or treatments for NTDs.

What new technologies are advancing Vangl2 research in Xenopus models?

Several emerging technologies are transforming our ability to study Vangl2 function in Xenopus models:

CRISPR/Cas9 genome editing enables precise modification of endogenous Vangl2 loci in Xenopus, allowing creation of knockout lines, specific point mutations, or tagged versions of the protein expressed at physiological levels. This approach overcomes limitations associated with transient knockdown methods and provides stable genetic models for long-term studies.

Live imaging techniques, including light sheet microscopy and spinning disk confocal microscopy, permit real-time visualization of Vangl2 dynamics in developing Xenopus embryos. When combined with fluorescently tagged Vangl2 constructs or specific antibody fragments, these approaches reveal how Vangl2 localization and activity change during key developmental processes such as convergent extension.

Proximity labeling methods such as BioID or APEX can identify novel Vangl2 interaction partners in specific cellular contexts. By expressing Vangl2 fused to a proximity labeling enzyme in Xenopus embryos, researchers can catalog proteins that associate with Vangl2 in different tissues or developmental stages, potentially revealing context-specific functions.

Optogenetic tools allow temporal and spatial control of Vangl2 activity in Xenopus embryos. Light-inducible dimerization or conformational change systems can be engineered to modulate Vangl2 function or interactions at precise developmental stages or in specific tissues, providing insights into its temporal and spatial requirements.

Single-cell transcriptomics and proteomics approaches enable comprehensive analysis of how Vangl2 manipulation affects cellular states and developmental trajectories. By comparing single-cell profiles between control and Vangl2-depleted embryos, researchers can identify downstream effects and potentially discover new Vangl2-regulated pathways.

How might knowledge of Vangl2 isoforms impact experimental design and data interpretation?

The discovery of multiple Vangl2 isoforms, particularly Vangl2-Long, has significant implications for experimental design and data interpretation in Xenopus and other vertebrate models:

Antibody selection requires careful consideration of isoform specificity. Researchers should determine whether their antibodies recognize all Vangl2 isoforms or are specific to certain variants . Using multiple antibodies targeting different epitopes can provide a more complete picture of Vangl2 expression and localization.

Knockdown and knockout strategies should account for potential isoform-specific effects. Traditional approaches targeting the shared coding sequence will affect all isoforms, potentially masking isoform-specific functions. More precise tools, such as isoform-specific morpholinos or CRISPR strategies targeting unique sequence elements, allow selective manipulation of specific Vangl2 variants .

Expression constructs for functional studies should be designed with awareness of alternative translation. When expressing Vangl2 from mRNA, researchers should consider whether their constructs include the upstream sequences necessary for Vangl2-Long translation . Modifications to these regions might inadvertently alter the isoform ratio, affecting experimental outcomes.

Western blot analysis should routinely assess multiple Vangl2 isoforms. Gels should be run with sufficient resolution to distinguish between Vangl2 and Vangl2-Long, and quantification should consider each isoform separately . Changes in the ratio between isoforms might be as functionally significant as changes in total Vangl2 levels.

Phenotypic interpretation should consider potential isoform-specific contributions. Different developmental processes might depend on specific Vangl2 isoforms or require precise isoform ratios . Therefore, seemingly contradictory results across studies might reflect differential manipulation of specific isoforms rather than inconsistent Vangl2 functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.