Recombinant Xenopus tropicalis Zinc transporter 7 (slc30a7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus tropicalis Zinc Transporter 7 (slc30a7)

Recombinant Xenopus tropicalis Zinc Transporter 7 (slc30a7) is a full-length, N-terminal His-tagged protein produced via bacterial expression in E. coli. This recombinant construct encodes the entire 390-amino-acid sequence (GenBank: Q6P3N9) of the native slc30a7 gene, which regulates zinc transport from the cytoplasm to the Golgi apparatus . The protein is critical for maintaining cellular zinc homeostasis and has been studied for its roles in apoptosis, insulin secretion, and disease pathogenesis .

Primary Biological Function

slc30a7 facilitates zinc transport into the Golgi apparatus, regulating intracellular zinc distribution and homeostasis . This activity supports processes like protein modification, signaling, and insulin maturation .

Key Research Insights

  1. Apoptosis Regulation

    • Overexpression of slc30a7 in peritoneal mesothelial cells reduces apoptosis under high-glucose conditions by inhibiting caspases (e.g., caspase 3/8) and activating the PI3K/Akt survival pathway .

    • siRNA-mediated knockdown increases apoptosis, highlighting its cytoprotective role .

  2. Pancreatic Islet Function

    • Combined deletion of slc30a7 and slc30a8 (ZnT8) abolishes glucose-stimulated insulin secretion (GSIS), indicating functional redundancy between ZnT7 and ZnT8 in insulin granule maturation .

    • slc30a7 deletion alone impairs glucose tolerance, reduces hepatic glycogen, and alters islet α/β-cell ratios .

  3. Interactions and Partners

    Interacting ProteinRoleInteraction Score
    slc39a9 (ZIP9)Zinc influx transporter (ZIP family)0.785
    slc39a11 (ZIP11)Cellular zinc uptake0.744
    slc30a9Uncharacterized zinc transporter0.606
    gtpbp10Ribosome maturation (GTPase family)0.514

    These interactions suggest a network involving zinc transporters and cellular machinery .

Production Methodology

  • Source: E. coli expression system .

  • Purification: Affinity chromatography via His tag .

  • Quality Control: SDS-PAGE, Western blotting, and functional assays .

Research Applications

  • Zinc Homeostasis Studies: Investigating Golgi-mediated zinc transport and its impact on protein trafficking .

  • Diabetes Research: Exploring the role of slc30a7 in insulin secretion and pancreatic β-cell function .

  • Cancer and Apoptosis: Evaluating its anti-apoptotic mechanisms in high-glucose environments .

Related Products and Comparative Data

ProductSpeciesTagPuritySource
Recombinant Rat SLC30A7Rattus norvegicusHis-taggedN/A
Recombinant Rhesus Macaque SLC30A7Macaca mulattaHis-taggedN/A
Recombinant Chicken SLC30A7Gallus gallusN/AN/A
Recombinant Mouse Slc30a7Mus musculusMyc/DDK-taggedN/A

Note: These products serve as comparative tools for cross-species functional studies .

Challenges and Considerations

  • Functional Redundancy: slc30a7 and slc30a8 exhibit compensatory roles in insulin secretion, complicating knockout studies .

  • Stability: Repeated freeze-thaw cycles degrade the protein; aliquoting is essential .

  • Species-Specific Variations: Functional differences between Xenopus and mammalian ZnT7 require cautious interpretation in translational studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc30a7; znt7; TEgg072f03.1; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
Target Protein Sequence
MLPLSIKDDEYKPPKFNLVRKVSGWIRSIFSDTTSRNLFCFLCLNLSFAFVELFYGIWSN SLGLISDSFHMFFDCTALLAGLAASVISRWKTNEAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGIERALDTPEVHHERLLPVSILGFLVNLIGIFVFQHGGGHGHSHESGHGHSHSLF NGSLSHGHSHSHGGSHGHSHGGGHGHSHSHGEGHGHSHDQSHKHGHGYGSSCHDEPPEEH TGSSKQILEGVFLHIVADALGSVGVIISTILMQRYGLMIADPICSMLIALLIFVSVIPLL KQSIGILMQRTPPSLDHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEA DARWILSQTHNIFTQAGVRQLYVQIDMAAM
Uniprot No.

Target Background

Function
This protein appears to facilitate zinc transport from the cytoplasm into the Golgi apparatus. It plays a role in regulating cellular zinc homeostasis.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis Zinc transporter 7 (slc30a7) and how does it function in zinc homeostasis?

Zinc transporter 7 (slc30a7) is a member of the cation diffusion facilitator (CDF) protein family, specifically belonging to the SLC30A subfamily (ZnT). Unlike ZIP transporters that increase cytoplasmic zinc, ZnT transporters function to decrease cytoplasmic zinc concentrations by facilitating zinc efflux from the cytoplasm .

Xenopus tropicalis slc30a7 consists of 390 amino acids with several key structural features including:

  • Transmembrane domains that form a zinc transport pathway

  • A histidine-rich loop region critical for zinc recruitment

  • N-terminal regions involved in protein localization

Functionally, slc30a7 primarily mobilizes zinc ions from the cytoplasm into the Golgi apparatus, playing a crucial role in maintaining zinc homeostasis within cellular compartments . This transport process is essential for various zinc-dependent enzymes and proteins that function within the secretory pathway.

What experimental models are suitable for studying Xenopus tropicalis slc30a7?

Several experimental models have proven effective for studying slc30a7:

  • Reconstituted proteoliposomes: Purified slc30a7 can be incorporated into artificial membrane vesicles to study direct transport activity, as demonstrated with similar transporters like ZAT1p .

  • Bacterial expression systems: E. coli has been successfully used for heterologous expression of recombinant slc30a7 with N-terminal His tags .

  • Yeast models: Both Saccharomyces cerevisiae and Schizosaccharomyces pombe have been employed to study zinc transporters through complementation assays, though with varying success depending on the specific transporter .

  • Mammalian cell cultures: For studies on subcellular localization and physiological function, mammalian cell lines transfected with slc30a7 can reveal important aspects of protein trafficking and zinc homeostasis.

The choice of model should align with specific research questions, with bacterial systems being optimal for protein production and purification, while eukaryotic systems provide better insights into physiological functions and regulation.

How does the structure of Xenopus tropicalis slc30a7 compare to human ZnT7?

While specific structural comparisons between Xenopus tropicalis slc30a7 and human ZnT7 are not explicitly detailed in the search results, recent cryo-EM structures of human ZnT7 provide valuable insights applicable to understanding the Xenopus ortholog :

The sequence homology and predicted structural similarity between these orthologs make Xenopus tropicalis slc30a7 a valuable model for understanding the fundamental mechanisms of zinc transport that are likely conserved across vertebrates.

What methods are recommended for optimizing expression and purification of recombinant Xenopus tropicalis slc30a7?

Optimizing expression and purification of recombinant Xenopus tropicalis slc30a7 requires attention to several key factors:

Expression System Selection:

  • E. coli is the most commonly used system for slc30a7 expression, as demonstrated by successful production of His-tagged protein spanning the full length (1-390 amino acids) .

  • BL21(DE3) or similar strains with reduced protease activity are recommended for membrane protein expression.

Expression Optimization Protocol:

  • Temperature modulation: Lower temperatures (16-20°C) after induction often improve proper folding of membrane proteins.

  • Induction conditions: Test various IPTG concentrations (0.1-1.0 mM) and induction times (4-24 hours).

  • Media supplements: Addition of 0.5-1.0 mM ZnSO₄ may stabilize the protein during expression.

Purification Strategy:

  • Membrane isolation: Thoroughly lyse cells and isolate membrane fractions using ultracentrifugation.

  • Solubilization: Test various detergents (DDM, LMNG, or C12E8) at concentrations just above their critical micelle concentration.

  • IMAC purification: Utilize the N-terminal His tag for initial purification on Ni-NTA resin.

  • Size exclusion chromatography: Further purify the protein to ensure homogeneity.

Storage Considerations:

  • Add 5-50% glycerol to the purified protein solution.

  • Store in Tris/PBS-based buffer at pH 8.0 with 6% trehalose to improve stability .

  • Aliquot and store at -80°C to avoid repeated freeze-thaw cycles.

This methodological approach yields protein suitable for structural and functional studies with purity greater than 90% as determined by SDS-PAGE .

How can researchers effectively measure zinc transport activity of recombinant slc30a7 in vitro?

Several complementary techniques can be employed to measure zinc transport activity of recombinant slc30a7:

Proteoliposome-Based Transport Assays:

  • Reconstitution procedure:

    • Purify slc30a7 in detergent solution

    • Mix with lipids (typically a mixture of phosphatidylcholine and phosphatidylethanolamine)

    • Remove detergent via dialysis or Bio-Beads

    • Confirm successful reconstitution by freeze-fracture electron microscopy

  • Radioisotope flux measurements:

    • Load proteoliposomes with or without zinc

    • Initiate transport by adding ⁶⁵Zn²⁺ to the external medium

    • At specific time points, filter samples and measure accumulated radioactivity

    • Calculate initial rates of transport

Similar approaches have been successfully used with zinc transporters such as ZAT1p, which demonstrated zinc uptake into proteoliposomes independent of a proton gradient .

Metal-Binding Assays:
In parallel with transport studies, direct metal binding can be assessed:

  • Metal blot analysis using ⁶⁵Zn²⁺ to identify binding regions

  • Isothermal titration calorimetry to determine binding affinities

  • Fluorescent zinc probes to visualize zinc binding in real-time

Transport Specificity Determination:
Test transport of other divalent metals (cadmium, copper, cobalt) to establish substrate specificity. For example, ZAT1p exhibited high specificity for zinc, transporting cadmium at only 1% of the zinc transport rate and showing no measurable cobalt transport .

What roles does the histidine-rich loop play in slc30a7 function and how can it be experimentally investigated?

The histidine-rich loop of slc30a7 plays a critical role in zinc transport efficiency:

Functional Significance:

  • Facilitates zinc recruitment to the transmembrane zinc-binding site

  • May serve as a zinc sensor or buffer during transport

  • Could potentially regulate transport activity in response to zinc availability

Experimental Approaches to Study the Histidine-Rich Loop:

  • Mutagenesis Studies:

    • Create alanine substitutions of key histidine residues

    • Generate truncations or internal deletions of loop regions

    • Measure resulting changes in transport activity and zinc binding

  • Structural Analysis:

    • Employ hydrogen-deuterium exchange mass spectrometry to assess conformational changes in the loop upon zinc binding

    • Use NMR to determine the solution structure of isolated loop peptides

    • Apply cryo-EM to capture different conformational states during transport

  • Zinc-Binding Characterization:

    • Perform isothermal titration calorimetry to measure binding affinities

    • Use zinc-responsive fluorescent probes to visualize binding in real-time

    • Apply metal blotting techniques to map zinc-binding regions, as done for ZAT1p which showed zinc binding primarily to the hydrophilic region from H182 to H232

  • Cross-Linking and Interaction Studies:

    • Perform chemical cross-linking followed by mass spectrometry to identify intra-protein contacts

    • Use proximity labeling approaches to identify proteins that interact with the histidine-rich loop

Recent structural analyses of human ZnT7, human ZnT8, and bacterial YiiP have provided insights into the mechanistic roles of this histidine-rich loop in facilitating efficient zinc transport .

How do disease-associated mutations in human SLC30A7 inform functional studies of Xenopus tropicalis slc30a7?

Human SLC30A7 (ZnT7) mutations have recently been linked to specific pathologies, providing valuable insights for functional studies of the Xenopus ortholog:

Known Pathogenic Variants:
A French family case study identified compound heterozygous variants in ZNT7 associated with:

  • Stunted growth

  • Testicular hypoplasia

  • Bone marrow failure

The specific variants included:

  • c.21dup (p.Asp8ArgfsTer3): Creating a premature stop codon in exon 1

  • c.842 + 15 T > C: Resulting in leaky mRNA splicing with a premature stop codon after exon 8

Translational Research Approaches:

  • Equivalent Mutation Generation:

    • Introduce corresponding mutations into Xenopus tropicalis slc30a7

    • Assess protein expression, stability, and localization

    • Measure resulting zinc transport activity

  • Functional Defect Characterization:

    • Compare wild-type and mutant proteins for zinc binding capacity

    • Assess subcellular localization and protein-protein interactions

    • Evaluate the impact on zinc-dependent cellular processes

  • Rescue Experiments:

    • Test whether wild-type Xenopus slc30a7 can complement the defects seen in human cells with ZNT7 mutations

    • Compare rescue efficiency between species to identify conserved functional domains

  • Structural Implications:

    • Map mutations onto the available structural models to understand mechanistic disruptions

    • Use computational approaches to predict stability and conformational changes

These studies are particularly important as ZNT7 deficiency has been linked to mild zinc deficiency, prostate cancer risk, and insulin resistance in mouse models, while human mutations cause growth retardation and bone marrow failure .

What is the relationship between slc30a7 and copper metabolism, particularly regarding cuproptosis?

Recent research has uncovered an unexpected relationship between SLC30A7 (ZnT7) and copper metabolism:

SLC30A7 and Cuproptosis Regulation:

  • SLC30A7 has been identified as a suppressor of cuproptosis (copper-dependent controlled cell death)

  • This suppression occurs through the JAK2/STAT3/ATP7A pathway

  • These findings represent the first identification of this regulatory function

Experimental Framework for Investigating this Relationship:

  • Protein Interaction Studies:

    • Co-immunoprecipitation to detect interactions between slc30a7 and copper transport proteins

    • Proximity labeling to identify neighboring proteins in the copper regulatory network

    • FRET-based approaches to measure direct interactions in living cells

  • Metal Cross-Talk Analysis:

    • ICP-MS measurements of intracellular copper and zinc levels in cells with altered slc30a7 expression

    • Live-cell imaging with metal-specific fluorescent probes to track metal redistribution

    • Competition assays to determine if zinc and copper transport are mutually influenced

  • Signaling Pathway Investigation:

    • Western blot analysis of JAK2/STAT3 phosphorylation status in relation to slc30a7 expression

    • ChIP-seq to identify STAT3 binding sites affected by slc30a7-mediated signaling

    • Pharmacological inhibition of JAK2/STAT3 signaling to assess impact on slc30a7's effects

  • Cuproptosis Response Measurement:

    • Cell viability assays under copper challenge with varying slc30a7 expression

    • Assessment of mitochondrial function and ATP production

    • Analysis of lipoylated protein abundance, a hallmark of cuproptosis

This research direction represents an emerging area of investigation, as indicated by the recent discovery that SLC30A7 suppresses cuproptosis through specific signaling pathways .

What structural features distinguish slc30a7 from other members of the SLC30 family?

Slc30a7 (ZnT7) possesses several distinctive structural features compared to other SLC30 family members:

Distinctive Structural Elements:

  • Histidine-Rich Loop Configuration:

    • The cytosolic histidine-rich loop of slc30a7 contains multiple "GHSH" motifs arranged in a specific pattern (GHSHESGHGHSHSLFNGSLSHGHSHSHGGSHGHSHGGGHGHSHSHGEGHGHSHDQSHKHGHGYGSSCHD)

    • This pattern differs from other ZnT proteins and likely contributes to unique zinc-binding properties

  • Transmembrane Domain Organization:

    • Based on structural studies of human ZnT7, the transmembrane domains form a zinc transport pathway with specific residues coordinating zinc

    • Recent cryo-EM structures have revealed details about the conformation changes during zinc transport

  • N-terminal Regulatory Domain:

    • The N-terminal region contains sequences that influence protein localization and dimerization

    • This region may be involved in specific protein-protein interactions unique to slc30a7

Structural Investigation Approaches:

  • Comparative Structural Analysis:

    • Overlay cryo-EM structures of different ZnT family members to identify unique features

    • Focus on conformational differences in the histidine-rich loop region

    • Compare zinc-binding sites to identify slc30a7-specific coordination patterns

  • Domain Swapping Experiments:

    • Exchange domains between slc30a7 and other ZnT proteins to determine functional specificity

    • Create chimeric proteins with mixed structural elements to identify critical regions

  • Molecular Dynamics Simulations:

    • Perform simulations to compare dynamic behaviors of slc30a7 with other family members

    • Evaluate potential energy landscapes for zinc transport through different structural conformations

The structural distinctiveness of slc30a7 likely underlies its specific function in zinc transport to the Golgi apparatus and potentially explains its recently discovered role in cuproptosis regulation .

How can researchers effectively investigate post-translational modifications of slc30a7?

Post-translational modifications (PTMs) can significantly influence slc30a7 function, and several methodologies can be employed to study them:

Key PTMs Relevant to slc30a7:

  • N-Glycosylation:

    • ZnT family proteins, including ZnT1, have been shown to undergo N-glycosylation

    • This modification can affect protein stability, trafficking, and function

  • Phosphorylation:

    • Potential regulatory mechanism affecting transport activity or protein interactions

    • May respond to cellular signaling pathways related to zinc homeostasis

  • Ubiquitination:

    • Could regulate protein turnover and degradation

    • May respond to changes in cellular zinc status

Methodological Approaches:

  • Identification of PTM Sites:

    • Mass Spectrometry-Based Proteomics:

      • Enrich for modified peptides using specific antibodies or chemical approaches

      • Perform LC-MS/MS analysis with electron transfer dissociation (ETD) fragmentation

      • Use software tools (e.g., MaxQuant, Proteome Discoverer) for site identification

    • Site-Directed Mutagenesis:

      • Mutate predicted modification sites to non-modifiable residues

      • Assess changes in protein function, localization, or stability

  • Functional Characterization:

    • Glycosylation Analysis:

      • Treat purified protein with PNGase F or EndoH to remove N-glycans

      • Analyze mobility shifts by SDS-PAGE

      • Use lectin-based affinity purification to enrich glycosylated forms

    • Phosphorylation Studies:

      • Employ phospho-specific antibodies for Western blotting

      • Use phosphatase treatments to assess functional consequences

      • Create phosphomimetic mutations (S/T to D/E) to simulate constitutive phosphorylation

  • Dynamic Regulation Analysis:

    • Pulse-Chase Experiments:

      • Label newly synthesized protein and track modifications over time

      • Assess stability and turnover rates of modified versus unmodified forms

    • Stimulus-Response Studies:

      • Manipulate cellular zinc levels and monitor changes in modification patterns

      • Activate relevant signaling pathways and assess impact on slc30a7 modifications

Understanding PTMs is particularly important as ZnT family proteins like ZnT1 have been shown to undergo modifications that affect their localization and function .

How should researchers interpret zinc transport data from slc30a7 functional studies?

Proper interpretation of zinc transport data requires careful consideration of multiple factors:

Key Considerations for Data Analysis:

  • Transport Kinetics Parameters:

    ParameterTypical RangeInterpretation
    Km (μM)1-20Affinity for zinc; lower values indicate higher affinity
    Vmax (nmol/min/mg)0.5-50Maximum transport capacity
    Transport rate (% control)VariableRelative activity compared to wild-type protein
  • Control Experiments Essential for Interpretation:

    • Empty vector/liposome controls to establish baseline

    • Positive controls using well-characterized zinc transporters

    • Non-functional mutants (e.g., binding site mutations) to confirm specificity

    • Transport assays with competing metals to determine selectivity

  • Common Data Challenges and Solutions:

    ChallengeSolution
    High background transportUse membrane-impermeant zinc chelators in assay buffer
    Variable expression levelsNormalize transport activity to protein expression
    Protein instabilityOptimize buffer conditions; screen stabilizing agents
    Non-specific bindingInclude appropriate controls with binding-deficient mutants
  • Statistical Analysis Approaches:

    • Use appropriate statistical tests for transport data (typically t-tests or ANOVA)

    • Account for biological replicates (n≥3) and technical replicates

    • Perform regression analysis for kinetic parameters

    • Consider using non-linear models for complex transport mechanisms

When interpreting results, it's important to note that zinc transporters like ZAT1p have shown specific transport properties, such as pH-independence and high selectivity for zinc over other metals like cadmium (1% of zinc transport rate) and cobalt (no measurable transport) .

What are the best approaches for comparing slc30a7 function across species, particularly between Xenopus tropicalis and human orthologs?

Cross-species functional comparison requires systematic approaches to identify conserved and divergent features:

Methodological Framework for Cross-Species Comparison:

  • Sequence and Structural Analysis:

    • Perform multiple sequence alignment of slc30a7 orthologs

    • Calculate percent identity/similarity across functional domains

    • Generate homology models based on available structures

    • Compare predicted zinc-binding sites and transport pathways

  • Functional Conservation Testing:

    • Complementation Assays:

      • Express Xenopus slc30a7 in human cell lines with ZNT7 knockout

      • Test ability to rescue zinc-dependent phenotypes

      • Compare rescue efficiency with human ZNT7 positive control

    • Transport Activity Comparison:

      • Express both orthologs under identical conditions

      • Measure zinc transport using standardized assays

      • Compare kinetic parameters (Km, Vmax) under varying conditions

  • Regulatory Element Conservation:

    • Compare response to zinc deficiency/excess

    • Assess post-translational modification patterns

    • Examine protein-protein interaction networks

  • Physiological Context Interpretation:

    ParameterHuman ZNT7Xenopus slc30a7Significance
    Tissue expressionUbiquitous, high in secretory tissuesSimilar pattern expectedConserved physiological roles
    Subcellular localizationPrimarily GolgiPredicted similarConserved intracellular function
    Disease relevanceGrowth retardation, testicular hypoplasia, bone marrow failure UnknownPotential model for human disease
  • Evolutionary Context Analysis:

    • Construct phylogenetic trees of zinc transporter families

    • Identify selection pressures on different domains

    • Consider environmental zinc availability differences between species' habitats

This approach has proven valuable, as studies with ZAT1p from Arabidopsis thaliana showed that ortholog function can vary across species: ZAT1 did not rescue increased zinc sensitivity in Saccharomyces cerevisiae ΔZrc1 mutants but did complement this phenotype in Schizosaccharomyces pombe ΔSpZrc1 mutants .

How might the emerging understanding of slc30a7's role in cuproptosis influence future research directions?

The discovery that SLC30A7 suppresses cuproptosis through the JAK2/STAT3/ATP7A pathway opens several promising research avenues:

Priority Research Questions:

  • Mechanistic Understanding:

    • How does a zinc transporter influence copper metabolism?

    • Is this effect direct (through metal interaction) or indirect (through signaling)?

    • Which domains of slc30a7 are essential for cuproptosis regulation?

  • Therapeutic Potential:

    • Could modulation of slc30a7 sensitize cancer cells to copper-induced cell death?

    • Might slc30a7 inhibitors have therapeutic potential in cancers with altered copper metabolism?

    • Are there natural compounds that modulate slc30a7's role in cuproptosis?

  • Physiological Relevance:

    • How does this function relate to the zinc transport activity?

    • Is there competitive regulation between zinc and copper homeostasis?

    • Under what physiological conditions is this regulatory function active?

Experimental Models for Investigation:

  • Cancer Research Models:

    • Glioblastoma multiforme (GBM) cell lines, as SLC30A7 has been studied in this context

    • Xenograft models with varied slc30a7 expression

    • Patient-derived organoids to assess clinical relevance

  • Metal Homeostasis Models:

    • Cell lines with CRISPR-engineered modifications to metal transport systems

    • Animal models with tissue-specific slc30a7 knockout

    • Systems with inducible expression to study temporal effects

This research direction is particularly significant as it represents the first identification of SLC30A7's role in cuproptosis regulation , suggesting a previously unrecognized intersection between zinc and copper homeostasis pathways that could have broad implications for understanding and treating diseases with metal metabolism dysregulation.

What are the most promising techniques for structural studies of slc30a7 and how might they advance our understanding of zinc transport mechanisms?

Several cutting-edge techniques show particular promise for advancing structural understanding of slc30a7:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Recently yielded high-resolution structures of human ZnT7 and ZnT8

    • Can capture different conformational states during transport cycle

    • Sample preparation considerations:

      • Detergent selection critical for maintaining native structure

      • Amphipol or nanodisc reconstitution may improve stability

      • Zinc concentration during preparation influences captured states

  • Integrated Structural Approaches:

    • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry):

      • Maps conformational dynamics during zinc binding and transport

      • Identifies regions with altered solvent accessibility

      • Complements static structural information from cryo-EM

    • SAXS (Small-Angle X-ray Scattering):

      • Provides low-resolution envelope in solution state

      • Useful for examining larger complexes and conformational ensembles

      • Can validate cryo-EM structures in different environments

  • Computational Methods:

    • Molecular Dynamics Simulations:

      • Model zinc movement through transport pathway

      • Predict conformational changes during transport cycle

      • Simulate effects of mutations on structure and function

    • Machine Learning Approaches:

      • Predict functional sites based on sequence conservation

      • Identify potential allosteric regulation sites

      • Model protein-protein interactions in zinc transport networks

Expected Advances in Understanding:

Structural FeatureCurrent UnderstandingPotential New Insights
Histidine-rich loopFacilitates zinc recruitment Conformational dynamics during transport cycle
Transmembrane domainForms zinc transport pathwayGating mechanism and ion selectivity determinants
Dimerization interfaceImportant for functionAllosteric regulation between monomers
Metal binding sitesCoordinates zinc during transportPotential secondary sites affecting transport kinetics

These approaches would build upon recent structural analyses that have revealed important details about zinc transport mechanisms, particularly focusing on the critical role of the histidine-rich loop in facilitating efficient zinc transport .

What are the most significant gaps in our understanding of slc30a7 function and what methodologies might address them?

Despite recent advances, several critical knowledge gaps remain in our understanding of slc30a7:

Key Knowledge Gaps and Research Approaches:

  • Physiological Regulation Mechanisms:

    • Gap: How is slc30a7 activity regulated in response to changing zinc levels?

    • Approaches:

      • Develop zinc-responsive biosensors to monitor transport activity in real-time

      • Investigate transcriptional, post-transcriptional, and post-translational regulation

      • Use proteomics to identify condition-specific interaction partners

  • Integration with Cellular Zinc Networks:

    • Gap: How does slc30a7 coordinate with other zinc transporters and metallothioneins?

    • Approaches:

      • Systems biology modeling of zinc homeostasis networks

      • Multi-omics approaches in models with altered slc30a7 expression

      • Simultaneous tracking of multiple transporters using differentially labeled proteins

  • Developmental and Tissue-Specific Functions:

    • Gap: How does slc30a7 function vary across tissues and developmental stages?

    • Approaches:

      • Generate tissue-specific and conditional knockout models

      • Perform single-cell transcriptomics to map expression patterns

      • Develop tissue-specific reporter systems for zinc transport activity

  • Disease Mechanism Understanding:

    • Gap: How do slc30a7 mutations lead to specific disease phenotypes like growth retardation?

    • Approaches:

      • Create animal models with disease-associated mutations

      • Perform metabolic profiling to identify affected pathways

      • Use patient-derived cells to validate mechanistic hypotheses

  • Metal Cross-Talk Mechanisms:

    • Gap: How does slc30a7 influence copper metabolism and cuproptosis?

    • Approaches:

      • Simultaneous tracking of zinc and copper using metal-specific probes

      • Structural studies of potential interactions with copper transport proteins

      • Targeted proteomics of metal-responsive signaling pathways

Addressing these gaps will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and systems biology to fully elucidate the complex role of slc30a7 in cellular metal homeostasis and its implications for human health and disease.

How might the study of Xenopus tropicalis slc30a7 contribute to therapeutic approaches for human diseases associated with zinc transporter dysfunction?

Research on Xenopus tropicalis slc30a7 has significant translational potential for human diseases:

Therapeutic Development Pathways:

  • Disease Model Development:

    • Xenopus models can be generated more rapidly than mammalian models

    • CRISPR/Cas9 editing can create humanized Xenopus slc30a7 variants

    • These models can serve as initial screening platforms for therapeutic candidates

  • Drug Discovery Applications:

    • Target Validation:

      • Confirm whether slc30a7 modulation affects disease-relevant phenotypes

      • Identify which functions (zinc transport vs. signaling) are most critical

    • Compound Screening:

      • Develop assays using purified recombinant Xenopus slc30a7

      • Screen for compounds that modify transport activity or protein interactions

      • Use Xenopus embryos for whole-organism phenotypic screening

  • Therapeutic Strategies with Translational Potential:

    ApproachMethodologyTherapeutic Application
    Transport activationSmall molecules enhancing zinc transportGrowth disorders, immune dysfunction
    Cuproptosis modulationCompounds affecting slc30a7-mediated copper regulationCancer treatment, particularly GBM
    Gene therapyCorrection of disease-causing mutationsCongenital zinc deficiency syndromes
    Protein replacementRecombinant slc30a7 delivery via nanoparticlesAcute zinc deficiency conditions
  • Biomarker Development:

    • Identify downstream effects of slc30a7 dysfunction

    • Develop diagnostic tests for early detection of zinc transport disorders

    • Create prognostic markers for treatment response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.