Recombinant Xenopus tropicalis Zinc transporter 8 (slc30a8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage state, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
slc30a8; Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
slc30a8
Target Protein Sequence
MKGSEEAYLVSDKATKMYSLTKDSEKNHPSKPPLQDEENPQSKYHCHNNNKKAYDARQRE QTFAKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLCSLWLSSK SSTTRLTFGWHRAEILGALMSVITIWLVTGVLVYLACERLIRPDYTIDGTVMLITSACAL GANLVLALILHQSGHGHSHAGGKHEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLISA LIIYFKPEYKMADPICTFIFSIFVLITTVTVLRDLLTVLMEGTPRGIHYSDVKQSILAVD GVKSVHSLHLWALTMNQVILSAHIATDIVGESKRILKDVTQNVFARFPFHSVTIQVEPIE DQSPECMFCYEPTQ
Uniprot No.

Target Background

Function
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, acting as a zinc-efflux transporter. Plays a significant role in zinc ion homeostasis and cellular distribution.
Database Links

KEGG: xtr:496450

UniGene: Str.27433

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis Zinc Transporter 8 (SLC30A8)?

Xenopus tropicalis Zinc Transporter 8 (xtZnT8) is a member of the Cation Diffusion Facilitator (CDF) family that mediates zinc flux away from the cytosol. As part of the SLC30A family, ZnT8 plays a crucial role in zinc homeostasis within cells. The protein is primarily responsible for transporting zinc from the cytosol into secretory vesicles through an H⁺-coupled antiport mechanism . XtZnT8 serves as an important model for studying the structure and function of this transporter, offering insights into its mammalian orthologs, particularly human ZnT8, which is strongly associated with type 2 diabetes (T2D) .

How does the structure of xtZnT8 compare to human ZnT8?

Xenopus tropicalis ZnT8 shares significant structural homology with human ZnT8. Protein alignment and phylogenetic analysis demonstrate that Xenopus transporters are generally closer to their mammalian orthologs than their teleost counterparts . The core structure includes:

  • Transmembrane domains forming a zinc transport pathway

  • A transmembrane zinc-binding site with specific coordination geometry

  • A cytosolic domain involved in dimerization and potentially zinc sensing

The cryo-EM structure of xtZnT8 reveals a lumen-facing conformation at low pH (5.5), which provides critical insights into the zinc release mechanism in the acidic environment of secretory granules. At this pH, the transmembrane zinc-binding site displays disrupted coordination geometry, suggesting that protons facilitate zinc release by disrupting zinc coordination .

What experimental systems are used to study recombinant xtZnT8?

Several experimental systems have proven effective for studying recombinant xtZnT8:

Expression SystemAdvantagesApplications
Xenopus laevis oocytesSurface localization enables transport studies; No net zinc transport at late stage of developmentRadiotracer (⁶⁵Zn) transport assays; Electrophysiology
Human embryonic kidney (HEK293) cellsHuman cellular environment; Good for localization studiesSubcellular localization; Protein-protein interaction studies
COS-1 cellsHigh transfection efficiency; Suitable for transport studiesRadiolabeled hormone uptake assays

The Xenopus oocyte system is particularly valuable because it allows for surface expression of ZnT8, enabling direct measurement of zinc transport despite ZnT8 being primarily a vesicular transporter in its native context .

How can zinc transport activity of recombinant xtZnT8 be assessed?

Zinc transport activity of recombinant xtZnT8 can be assessed through several complementary methodologies:

  • Radiotracer transport assays using ⁶⁵Zn:

    • This approach employs Xenopus laevis oocytes expressing xtZnT8 at the surface

    • Oocytes are microinjected with ⁶⁵Zn and efflux is measured over time

    • Controls include water-injected oocytes to assess background transport

  • Zinc binding assays:

    • In vitro binding assays to assess zinc coordination at different pH values

    • Isothermal titration calorimetry (ITC) to determine binding affinity

    • Fluorescent zinc probes to visualize zinc transport in live cells

  • pH-dependent transport assays:

    • Studies conducted at varying pH values (typically pH 5.5 to mimic granule lumen and pH 7.5 to mimic cytosol)

    • These assays reveal how proton gradients affect zinc transport activity

The radiotracer assay in Xenopus oocytes is particularly informative as it allows direct measurement of zinc efflux, which mirrors the physiological role of ZnT8 in transporting zinc from the cytosol into secretory granules when expressed endogenously.

How does pH affect the zinc transport mechanism of xtZnT8?

The zinc transport mechanism of xtZnT8 is significantly influenced by pH, reflecting its physiological function in acidic secretory granules:

  • Structural changes at low pH:

    • Cryo-EM structure of xtZnT8 at pH 5.5 reveals an empty transmembrane zinc-binding site with disrupted coordination geometry

    • This contrasts with the zinc-bound structure at pH 7.5, indicating pH-dependent structural changes

  • Proton-coupled transport:

    • ZnT8 functions as an H⁺-coupled antiporter, where protons move in the opposite direction to zinc

    • At low pH (granule lumen), protons disrupt zinc coordination at the transmembrane binding site, facilitating zinc release

  • Transport directionality:

    • The pH gradient across the granule membrane (acidic inside) helps drive zinc accumulation in insulin secretory granules

    • This process is essential for proper insulin crystallization and storage

The pH-dependent mechanism ensures that zinc is efficiently transported into secretory granules and properly released when needed, highlighting the adaptation of xtZnT8 to its specialized function in secretory cells.

What are the structural differences between ZnT8 isoforms and how do they impact cellular localization?

ZnT8 exists in two main isoforms (splice variants) that differ in their N-terminal regions and exhibit distinct cellular localization patterns:

  • Long isoform:

    • Contains an additional 49 amino acid N-terminal extension

    • When expressed in HEK293 cells, localizes to both plasma membrane and internal membranes

    • This differs from other ZnT transporters, where longer isoforms typically localize to internal membranes only

  • Short isoform:

    • Lacks the 49 amino acid N-terminal extension

    • Predominantly localizes to internal membranes in HEK293 cells

    • Shows more restricted distribution compared to the long isoform

Interestingly, both isoforms localize to the cell surface when expressed in Xenopus laevis oocytes, enabling transport studies. This differential localization suggests distinct functional roles for each isoform, potentially contributing to cell-specific zinc homeostasis mechanisms .

The differential localization of ZnT8 isoforms has potential implications for β-cell function and diabetes pathophysiology, as altered zinc handling in different cellular compartments could affect insulin processing and secretion.

How can recombinant xtZnT8 be used to study diabetes-associated variants?

Recombinant xtZnT8 provides a valuable platform for studying diabetes-associated variants, particularly those affecting the human ortholog:

  • Structure-function analysis:

    • The cryo-EM structure of xtZnT8 can guide site-directed mutagenesis to create equivalents of human disease-associated variants

    • Structure-based analyses help predict how specific mutations might affect zinc coordination and transport

  • Comparative transport studies:

    • Radiotracer assays can quantitatively compare zinc transport kinetics between wild-type and variant forms

    • Similar approaches have been used to study the R325W variant in human ZnT8, where a single nucleotide polymorphism (SNP rs13266634) is associated with type 2 diabetes risk

  • Conservation analysis:

    • Analysis of amino acid conservation across species can identify functionally critical residues

    • For example, the amino acid at position 325 (site of the R325W variant) is poorly conserved across species, suggesting potential functional flexibility

The use of recombinant xtZnT8 offers significant advantages over human samples in terms of availability, ease of manipulation, and the ability to conduct functional studies in well-established experimental systems.

What methodologies can be used to investigate zinc coordination in xtZnT8?

Several sophisticated methodologies can be employed to investigate zinc coordination in xtZnT8:

  • Cryo-electron microscopy (cryo-EM):

    • Provides high-resolution structures of xtZnT8 in different conformational states

    • Reveals atomic details of zinc-binding sites and coordination geometry

    • Can capture pH-dependent structural changes relevant to transport mechanism

  • X-ray absorption spectroscopy (XAS):

    • Provides information about the coordination environment around zinc atoms

    • Can determine the number and identity of coordinating ligands

    • Useful for validating structural models derived from cryo-EM

  • Molecular dynamics simulations:

    • Model zinc movement through the transport pathway

    • Simulate effects of pH changes on protein structure and zinc coordination

    • Predict energetics of zinc binding and release

  • Site-directed mutagenesis combined with functional assays:

    • Systematic mutation of putative zinc-coordinating residues

    • Assessment of transport activity using radiotracer assays

    • Correlation of structural changes with functional outcomes

These complementary approaches provide a comprehensive understanding of how xtZnT8 binds and transports zinc, and how this process is regulated by pH and other factors.

How can heterologous expression systems be optimized for xtZnT8 functional studies?

Optimizing heterologous expression systems is crucial for obtaining reliable functional data on xtZnT8:

  • Expression system selection:

    • Xenopus laevis oocytes: Ideal for transport studies due to surface localization of both ZnT8 isoforms

    • Mammalian cells (HEK293): Better for studying subcellular localization and protein interactions

    • Each system should be chosen based on specific experimental goals

  • Construct design considerations:

    • Codon optimization for the host system

    • Addition of epitope tags for detection (e.g., V5 tag)

    • Signal sequence modification for proper membrane targeting

    • Consideration of isoform-specific functions (long vs. short isoform)

  • Expression optimization parameters:

    ParameterOptimization Strategy
    TemperatureLower temperature (16-18°C) often improves folding
    Expression timeLonger for oocytes (2-4 days), shorter for mammalian cells
    Medium compositionSupplementation with zinc may be necessary
    Transfection methodLipofection for mammalian cells, microinjection for oocytes
  • Functional validation:

    • Western blotting to confirm expression

    • Surface biotinylation to verify membrane localization

    • Zinc transport assays to confirm functionality

Proper optimization ensures that the recombinant protein accurately reflects the native transporter's properties and yields reliable functional data.

What are the challenges in expressing and purifying functional recombinant xtZnT8?

Researchers face several significant challenges when working with recombinant xtZnT8:

  • Protein stability issues:

    • Membrane proteins are often unstable when removed from their native lipid environment

    • Zinc transporters may aggregate during purification due to exposed hydrophobic surfaces

    • The presence of zinc during purification may be necessary to maintain protein stability

  • Expression level limitations:

    • Overexpression can lead to misfolding or aggregation

    • Toxicity may result from disrupting cellular zinc homeostasis

    • Balance between sufficient yield and proper folding is critical

  • Functional preservation:

    • Maintaining transport activity during purification is challenging

    • Detergent selection is crucial as it can affect protein structure and function

    • Reconstitution into lipid environments must preserve native conformation

  • Structural heterogeneity:

    • Different conformational states may exist in solution

    • pH-dependent structural changes complicate structural studies

    • Both zinc-bound and zinc-free states may be present simultaneously

These challenges necessitate careful optimization of expression and purification protocols, often requiring iterative refinement to achieve sufficient yields of functional protein for structural and biochemical studies.

How does xtZnT8 research inform our understanding of pancreatic β-cell function?

Research on xtZnT8 provides valuable insights into fundamental aspects of pancreatic β-cell function:

  • Zinc homeostasis in insulin processing:

    • ZnT8 transports zinc into insulin secretory granules, where zinc is essential for insulin crystallization

    • Understanding this process helps elucidate the mechanisms of insulin storage and secretion

  • Structure-function relationships:

    • The cryo-EM structure of xtZnT8 reveals how protons facilitate zinc release in the acidic environment of secretory granules

    • This mechanism is likely conserved in human β-cells and critical for proper insulin processing

  • Pathophysiological implications:

    • Variants in human ZnT8 are associated with type 2 diabetes risk

    • The R325W variant (SNP rs13266634) may alter zinc transport kinetics, affecting insulin processing

    • The different cellular localization of ZnT8 isoforms suggests complex regulatory mechanisms in β-cells

  • Evolutionary insights:

    • Comparing xtZnT8 with human ZnT8 reveals conserved features essential for function

    • Divergent features may indicate species-specific adaptations in zinc metabolism

By using xtZnT8 as a model system, researchers can overcome limitations of human samples and perform detailed functional studies that would otherwise be challenging.

What implications does xtZnT8 research have for understanding type 2 diabetes mechanisms?

Research on xtZnT8 has several important implications for understanding type 2 diabetes mechanisms:

  • Genetic risk variants:

    • The human ZnT8 R325W variant is associated with type 2 diabetes risk

    • Studying equivalent mutations in xtZnT8 can help elucidate how these variants affect transporter function

  • Zinc homeostasis disruption:

    • Altered zinc transport may disrupt insulin crystallization and storage

    • This could contribute to β-cell dysfunction and reduced insulin secretion capacity

    • The differential localization of ZnT8 isoforms suggests potential for compartment-specific zinc dysregulation

  • Autoimmunity connections:

    • ZnT8 is a major autoantigen in type 1 diabetes

    • Understanding its structure and cellular localization helps explain epitope accessibility

    • This knowledge may inform strategies to prevent or treat autoimmune diabetes

  • Therapeutic target potential:

    • Detailed structural and functional characterization of xtZnT8 provides a foundation for drug discovery

    • Compounds that modulate ZnT8 function could potentially improve β-cell function in diabetes

    • Isoform-specific targeting might offer precision therapeutic approaches

The comparative study of xtZnT8 and human ZnT8 enables researchers to develop more comprehensive models of how zinc dysregulation contributes to diabetes pathophysiology, potentially leading to novel therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.