Recombinant Xenopus tropicalis Zinc transporter ZIP14 (slc39a14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc39a14; Metal cation symporter ZIP14; Solute carrier family 39 member 14; Zrt- and Irt-like protein 14; ZIP-14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-462
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
slc39a14
Target Protein Sequence
GPTPSTGKELSAASFLQDILQRYGENESLSMPQLQSLLENLEVGKGGGNQRNMSQCLSSS TLFAAHNLTSGSVVDAEGFQSFCPTILQQLETRACQESPAFQNETTPGAEGRPSPGEVWG YGFLCVTVISLCSLFGAGVVPFMKKACYKRLLLFCIALAIGTLFSNALFQLIPEAFGFNP LEDSYVFTSSVIFGGFYLFFFTEKVLKMMLKQKHEHGHSHYSADTSKRDAEEGVTEKLQN GDLDHMIPPPHGSESDLRGDEKAVQQQDLPGQQSSCYWLKGIRYSDIGTLAWMITLSDGL HNFIDGLAIGASFTVSVFQGVSTSIAILCEEFPHELGDFVILLNAGMSIPQALFFNFLSA CCCYLGLAFGILAGSHFSSNWIFALAGGMFLYIALSDMFPEMNEVSKEDEEGGRAFSAFM IQNAGLLTGFAIMLLLTTFSGQIQLG
Uniprot No.

Target Background

Function
Recombinant Xenopus tropicalis Zinc transporter ZIP14 (slc39a14) is an electroneutral transporter located in the plasma membrane. It mediates the cellular uptake of divalent metal cations such as zinc, manganese, and iron, which are essential for tissue homeostasis, metabolism, development, and immunity. This transporter functions as an energy-dependent symporter, transporting an electroneutral complex composed of a divalent metal cation and two bicarbonate anions across membranes. In addition to these endogenous cellular substrates, ZIP14 can also import cadmium, a non-essential metal that is cytotoxic and carcinogenic.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What makes Xenopus tropicalis a suitable model organism for studying ZIP14 function?

Xenopus tropicalis offers several advantages as a model organism for ZIP14 research:

  • Unlike Xenopus laevis, X. tropicalis possesses a true diploid genome with high conservation of gene synteny with the human genome, making it an ideal genetic model organism for biomedical research .

  • X. tropicalis features externally developing embryos that are easily accessible for manipulation, facilitating experimental procedures and post-factum analysis .

  • The relatively short life cycle of X. tropicalis compared to other vertebrate models allows for faster generation of genetic models .

  • Modern genome editing techniques such as CRISPR/Cas9 are highly efficient in X. tropicalis, permitting the fast and cost-effective generation of genetic models for human disease .

  • The organism's transparent tadpole stage allows for visualization of internal processes, particularly valuable for studying metal transport and accumulation in vivo .

How does the structure and function of Xenopus tropicalis ZIP14 compare to its human ortholog?

The ZIP14 protein in X. tropicalis shares significant structural and functional similarities with human ZIP14:

  • Both belong to the LZT (LIV-1 zinc transporter) subfamily of ZIP transporters, characterized by the distinctive metalloprotease motif EXPHEXGD .

  • Similar to human ZIP14, X. tropicalis ZIP14 functions as a transmembrane metal ion importer capable of transporting multiple divalent metal ions including zinc, iron, and manganese .

  • The protein's molecular weight is comparable in both species, with immunoreactive bands of approximately 50-65 kDa observed in Western blot analyses, along with potential multimers at approximately 100 and 150 kDa .

  • Both human and X. tropicalis ZIP14 predominantly localize to the plasma membrane when expressed in cell systems, with evidence of endosomal localization related to iron uptake from transferrin .

  • Conservation of functional domains suggests that the mechanisms of metal ion selectivity and transport are preserved between species.

What expression systems are most effective for producing recombinant Xenopus tropicalis ZIP14?

Based on experimental evidence, several expression systems have proven effective for recombinant X. tropicalis ZIP14 production:

  • Mammalian cell systems: HEK 293H cells have been successfully utilized for transient transfection with ZIP14 cDNA, producing functional protein that localizes to the plasma membrane and demonstrates metal transport activity .

  • Insect cell systems: Sf9 insect cells infected with baculovirus containing ZIP14 cDNA show robust expression with proper localization to the plasma membrane and functional transport activity .

  • Expression verification: Western blot analysis reveals characteristic immunoreactive bands at approximately 50 kDa (the predicted molecular mass being 54 kDa), with additional bands at approximately 100 and 150 kDa representing potential multimers .

The choice of expression system depends on experimental goals:

  • For functional studies: HEK 293H and Sf9 cells both demonstrate proper protein localization and transport function

  • For structural studies: Insect cell systems may provide higher protein yields

  • For in vivo studies: Direct genome editing in X. tropicalis embryos using CRISPR/Cas9 is recommended

What methods can be used to measure ZIP14-mediated metal transport in experimental systems?

Several methodological approaches can quantify ZIP14-mediated metal transport:

Radioactive trace metal uptake assays:

  • 65Zn and 59Fe radioactive isotopes have been successfully used to measure ZIP14-mediated transport in transfected cells .

  • This approach allows for quantitative measurement of transport kinetics.

  • Typical protocol involves exposing cells expressing recombinant ZIP14 to isotope-containing medium for 15-60 minutes, followed by washing and measuring cell-associated radioactivity .

Competitive transport studies:

  • Adding excess non-radioactive competitive metals (e.g., 100-fold molar excess of zinc) to uptake medium can determine transport specificity and competition between different metal substrates .

  • For example, excess zinc has been shown to reduce ZIP14-mediated iron uptake by 60-80% in different cell types .

Chemical inhibition studies:

  • Membrane-impermeant chelators like bathophenanthroline sulfonate (BPS) can be used to determine the oxidation state of transported iron .

  • BPS inhibits ZIP14-mediated uptake of iron from ferric citrate in a dose-dependent manner, suggesting that iron is transported in the ferrous (Fe2+) form .

siRNA-mediated knockdown:

  • RNA interference using ZIP14-specific siRNA in cells with endogenous ZIP14 expression (e.g., AML12 mouse hepatocytes) can confirm transport function and assess compensatory mechanisms .

  • This approach has shown that ZIP14 suppression reduces both iron and zinc uptake and affects downstream processes like metallothionein expression .

How can CRISPR/Cas9 genome editing be optimized for generating Xenopus tropicalis ZIP14 mutant models?

Generating X. tropicalis ZIP14 mutant models using CRISPR/Cas9 requires optimization of several parameters:

Guide RNA design considerations:

Delivery methods:

  • Microinjection of CRISPR/Cas9 components into fertilized eggs at the one-cell stage is most efficient for germline transmission .

  • For mosaic disruption models (beneficial for studying tumor suppressor genes), injection at later developmental stages may be preferred .

Verification of editing efficiency:

  • T7 endonuclease assay or direct sequencing of PCR products spanning the target site.

  • Western blotting to confirm protein reduction/absence.

  • Functional assays measuring zinc and iron transport to verify physiological impact.

Phenotypic characterization:

  • Metal content analysis in tissues using inductively coupled plasma mass spectrometry (ICP-MS).

  • Histological examination focusing on tissues with high ZIP14 expression (liver, pancreas).

  • Investigation of developmental abnormalities, particularly in processes dependent on zinc homeostasis.

The mosaic genome editing approach is particularly valuable for studying ZIP14 in cancer models, as described for tumor suppressor genes in X. tropicalis .

What are the implications of ZIP14's role in non-transferrin-bound iron (NTBI) uptake for modeling iron overload disorders in Xenopus tropicalis?

ZIP14's capacity to transport NTBI has significant implications for modeling iron-related disorders:

Pathophysiological relevance:

  • NTBI is commonly found in plasma of patients with hemochromatosis and transfusional iron overload, contributing to hepatic iron loading that characterizes these diseases .

  • ZIP14-mediated NTBI uptake may represent a crucial pathway for iron accumulation in hepatocytes during iron overload conditions .

Model development strategy:

  • Generating X. tropicalis models with ZIP14 overexpression could simulate accelerated hepatic iron loading.

  • Conversely, ZIP14 knockdown or knockout models might demonstrate protection against iron overload under high-iron conditions.

  • Combining ZIP14 manipulation with high-iron diets or iron injection protocols can simulate disease states.

Analytical approaches:

  • Tissue iron quantification using histochemical staining (Perl's Prussian blue) and biochemical measurement.

  • Gene expression analysis focusing on iron-regulatory genes (hepcidin, ferroportin, ferritin).

  • Functional assessment of organ toxicity, particularly focusing on liver function.

Therapeutic implications:

  • X. tropicalis ZIP14 models could be used to test iron chelation strategies.

  • Identifying compounds that modulate ZIP14 transport activity could lead to novel therapeutic approaches for iron overload disorders.

  • The models could help distinguish between transferrin-dependent and independent pathways of iron loading, informing targeted intervention strategies.

This approach takes advantage of X. tropicalis's diploid genome and genetic conservation with humans to provide translational insights into iron overload pathophysiology .

How does ZIP14 interact with other metal transporters in maintaining metal homeostasis, and how can these interactions be studied in Xenopus tropicalis?

ZIP14 functions within a complex network of metal transporters, and studying these interactions requires sophisticated approaches:

Key interacting transporters:

  • ZIP8 (SLC39A8): Closely related to ZIP14, with overlapping but distinct metal transport capabilities and tissue distribution .

  • Ferroportin (SLC40A1): The cellular iron exporter that works in opposition to ZIP14 to maintain iron balance.

  • DMT1 (SLC11A2): Another major iron importer that may complement or compete with ZIP14 function.

  • Other ZIP family members that contribute to zinc homeostasis.

Experimental approaches to study interactions:

  • Co-expression studies:

    • Simultaneous manipulation of multiple transporters using multiplexed CRISPR/Cas9 in X. tropicalis.

    • Analysis of compensatory changes in expression of related transporters when ZIP14 is altered.

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation to identify physical interactions between ZIP14 and other transporters.

    • Proximity ligation assays to detect close associations in vivo.

    • FRET/BRET approaches to monitor dynamic interactions in living cells.

  • Functional cooperation assessment:

    • Metal competition studies to determine how the presence of multiple transporters affects metal uptake kinetics.

    • Sequential knockdown experiments to establish hierarchical relationships in metal transport.

  • In vivo metal trafficking:

    • Tracking labeled metals through different cellular compartments in the presence/absence of specific transporters.

    • Real-time imaging of metal distribution in transparent X. tropicalis tadpoles after genetic manipulation.

Data interpretation framework:

This systematic approach leverages X. tropicalis as a model system to unravel the complex interplay between ZIP14 and other transporters in maintaining metal homeostasis.

How can researchers distinguish between the transport roles of ZIP14 for different metals (zinc, iron, manganese) in Xenopus tropicalis experimental systems?

Distinguishing between ZIP14's metal transport specificities requires sophisticated experimental designs:

Metal-specific transport kinetics:

  • Conduct competition assays with increasing concentrations of non-radioactive metals to determine relative affinities for different substrates .

  • Compare IC50 values for inhibition of transport of one metal by others to establish preference hierarchies.

  • Measure transport rates under identical conditions to determine which metals are preferentially transported.

Structure-function analysis:

  • Generate ZIP14 mutants with targeted modifications in putative metal-binding domains.

  • Assess how specific mutations differentially affect transport of zinc versus iron versus manganese.

  • Use X. tropicalis as an in vivo system to validate findings from cell-based assays.

Metal-specific physiological outcomes:

  • Design experiments that isolate phenotypes specific to each metal's deficiency or excess.

  • For zinc: Analyze effects on zinc-finger transcription factors, immune function, and pancreatic insulin secretion .

  • For iron: Examine hematologic parameters, hepatic iron loading, and expression of iron-regulatory genes .

  • For manganese: Focus on neurological functions and manganese accumulation in bile .

Environmental manipulation protocols:

  • Subject X. tropicalis models to specific metal deficiencies or excesses to identify ZIP14-dependent responses.

  • Use chelators with different metal specificities to isolate transport pathways.

  • Develop metal sensors that can distinguish between different metals in vivo.

Proposed experimental design table:

Experimental ApproachZinc TransportIron TransportManganese Transport
Radiotracer uptake65Zn59Fe54Mn
Competitive inhibitionCu2+, Cd2+Zn2+, BPSZn2+, Fe2+
Tissue focusPancreas, immune cellsLiver, macrophagesBrain, liver, bile duct
Phenotypic readoutInsulin secretion, metallothionein expressionHepcidin regulation, ferritin levelsBile manganese, neurological assessment
Disease relevanceDiabetes, immunodeficiencyHemochromatosis, anemiaHypermanganesemia

This comprehensive approach enables researchers to delineate the specific roles of ZIP14 in transporting different metals in X. tropicalis, providing insights into both basic biology and disease mechanisms.

What is the relationship between ZIP14 expression and cancer development, and how can this be investigated using Xenopus tropicalis models?

The relationship between ZIP14 and cancer presents a complex research opportunity in X. tropicalis models:

Existing evidence of ZIP14-cancer connections:

  • ZIP14 is downregulated in hepatocellular carcinoma (HCC), correlating with depleted zinc levels in cancer cells .

  • Alternative splicing of the ZIP14 gene (SLC39A14) occurs in colorectal cancer, with the SLC39A14-exon4B variant consistently and selectively enriched .

  • These findings suggest ZIP14 may function as a tumor suppressor in some contexts, while specific variants might contribute to cancer progression in others.

Experimental approaches in X. tropicalis:

  • Generating cancer models with ZIP14 manipulation:

    • Use mosaic CRISPR/Cas9 genome editing to disrupt ZIP14 in specific tissues .

    • Create models with tissue-specific overexpression of normal or cancer-associated ZIP14 variants.

    • Combine ZIP14 manipulation with known oncogene activation or tumor suppressor inactivation.

  • Analysis of metal homeostasis in cancer development:

    • Monitor changes in cellular zinc, iron, and manganese during tumor progression.

    • Examine how altered metal homeostasis affects cancer-related signaling pathways.

    • Test whether restoring ZIP14 expression or function can reverse cancer-associated metal imbalances.

  • Investigation of ZIP14 splicing variants:

    • Characterize the expression and function of X. tropicalis ZIP14 splice variants.

    • Develop methods to detect specific splice variants as potential biomarkers.

    • Determine whether cancer-associated splicing patterns alter metal transport capability.

  • Therapeutic targeting strategies:

    • Test whether ZIP14-mediated metal transport can be exploited for targeted delivery of metal-conjugated therapeutics.

    • Evaluate the potential of ZIP14 modulation as a cancer treatment approach.

    • Develop screening platforms to identify compounds that regulate ZIP14 expression or function.

Experimental design considerations:

Research QuestionExperimental ApproachExpected OutcomeClinical Relevance
Is ZIP14 downregulation causative in HCC?CRISPR knockout in X. tropicalis liverIncreased susceptibility to hepatic tumorsValidation of ZIP14 as tumor suppressor
How do cancer-specific splice variants affect function?Expression of specific variants in X. tropicalisAltered metal transport preferencesSplice variant-specific targeting
Can ZIP14 restoration inhibit cancer?Inducible ZIP14 expression in tumor modelsReduced tumor growth if ZIP14 is tumor suppressiveSupport for ZIP14-targeting therapies
Are ZIP14 effects cancer-type specific?Comparative analysis across tissue typesVariation in ZIP14 impact by tissue contextGuidance for cancer-specific approaches

X. tropicalis provides a valuable model system for these investigations due to its diploid genome with high synteny to humans and the efficiency of genetic manipulation techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.