Recombinant Xylanimonas cellulosilytica Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, with associated additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
tatC; Xcel_0071; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Xylanimonas cellulosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07)
Target Names
tatC
Target Protein Sequence
MVSLTSVPPYADATPDTRASSGPAPGRRKRMPLREHLAELRTRLLLVAGGLVVGAVVGWL LYDPLLVLLTRPLHLAAATQHKDIALNFTALGSPLDTRIKVSLFLAVMVTCPWWLYQVWA FVTPGLTRREKRHAYGFLGAAVPLFLGGAGLSWWVLPHAVDIFASFVPAGSSQYVNAQEY LSFVMRLVLAFGVAFVAPVLLVALNLAGIVRHETLARGWRWAVLLAFVFAAVMTPTPDAL TMVLVAAPICALYFGALGVAVWHDRRADRRTAPAAA
Uniprot No.

Target Background

Function

Recombinant Xylanimonas cellulosilytica Sec-independent protein translocase protein TatC (tatC) is a component of the twin-arginine translocation (Tat) system. This system transports large, folded proteins across membranes. These proteins possess a characteristic twin-arginine motif within their signal peptide. TatC, in conjunction with TatB, forms a receptor complex that directly interacts with Tat signal peptides.

Database Links
Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Xylanimonas cellulosilytica and why is it significant for TatC research?

Xylanimonas cellulosilytica is the type species of the genus Xylanimonas belonging to the actinobacterial family Promicromonosporaceae. It was first isolated from a decayed tree (Ulmus nigra) in Salamanca, Spain. The organism is of particular interest due to its ability to hydrolyze cellulose and xylan, possessing a variety of hydrolytic enzymes including cellulases and xylanases .

The complete genome of X. cellulosilytica has been sequenced and is 3,831,380 bp long, consisting of one chromosome plus an 88,604 bp plasmid. The genome contains 3,485 protein-coding genes and 61 RNA genes . This genomic information provides a valuable foundation for understanding protein transport systems in this organism, including the Sec-independent pathway involving TatC.

X. cellulosilytica is particularly valuable for TatC research as it represents a Gram-positive actinobacterial model that complements studies in Gram-negative bacteria like Escherichia coli, potentially revealing evolutionary adaptations in the Tat pathway across different bacterial phyla.

What is the Twin Arginine Translocation (Tat) pathway and what role does TatC play?

The Twin Arginine Translocation (Tat) pathway is a specialized protein transport system that exports fully folded proteins across the cytoplasmic membranes of prokaryotes and the thylakoid membranes of chloroplasts. Unlike the Sec pathway, which transports unfolded proteins, the Tat pathway has the remarkable ability to transport proteins that have already attained their tertiary structure .

TatC functions as the core component of the Tat receptor complex. In Escherichia coli and other Gram-negative bacteria, the Tat machinery comprises three components: TatA, TatB, and TatC. The polytopic membrane protein TatC forms the core of the Tat receptor and contains two binding sites for the sequence-related TatA and TatB proteins :

  • A "polar" cluster binding site formed by TatC transmembrane helices (TMH) 5 and 6, which is occupied by TatB in the resting receptor and exchanges for TatA during receptor activation.

  • A second binding site further along TMH6, which is occupied by TatA in the resting state.

When a protein with a twin-arginine signal peptide is recognized by the TatBC complex, this triggers receptor organization and recruitment of additional TatA molecules to form the active Tat translocon, enabling protein transport across the membrane .

How can I determine if my protein of interest is transported via the Tat pathway in X. cellulosilytica?

To determine if your protein of interest utilizes the Tat pathway in X. cellulosilytica, employ the following methodological approach:

This systematic approach will provide robust evidence regarding the involvement of the Tat pathway in transporting your protein of interest.

What expression systems are most suitable for producing recombinant X. cellulosilytica TatC?

Several expression systems can be employed for the production of recombinant X. cellulosilytica TatC, each with specific advantages and limitations:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yields, rapid growth, geneticallymanipulable, cost-effectivePotential folding issues with membrane proteins, different lipid compositionUse specialized strains (C41, C43), lower induction temperature (16-20°C), mild inducers
Bacillus subtilisGram-positive background, high secretion capacity, GRAS statusLower yields than E. coli, potential proteolysisUse protease-deficient strains, optimize codon usage
Pichia pastorisEukaryotic folding machinery, high-density culturesSlower growth, glycosylation may occurMethanol-inducible promoters, optimize media composition
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsExpensive, limited scaleSupplement with lipids/detergents, optimize redox conditions

For initial studies, E. coli expression using specialized membrane protein vectors (pET-based with fusion tags like His6, MBP, or SUMO) is recommended. The C41(DE3) and C43(DE3) strains, derived from BL21(DE3), are particularly useful as they have adaptations that mitigate the toxicity associated with membrane protein overexpression.

Expression should be optimized by:

  • Testing multiple constructs with varying N- and C-terminal boundaries

  • Screening different detergents for solubilization (DDM, LDAO, LMNG)

  • Testing expression at lower temperatures (16-20°C) with reduced inducer concentrations

  • Including membrane-mimetic environments during purification (nanodiscs, amphipols)

What purification strategies yield the highest quality X. cellulosilytica TatC for structural studies?

Obtaining high-quality, homogeneous recombinant TatC protein requires a multi-step purification strategy:

  • Initial solubilization: After cell lysis, membrane fractions are isolated by ultracentrifugation and solubilized using appropriate detergents. DDM (n-dodecyl-β-D-maltopyranoside) at 1-2% is a good starting point, with gentle agitation for 1-2 hours at 4°C.

  • Affinity chromatography: The solubilized protein can be captured using:

    • IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs

    • Amylose resin for MBP fusion proteins

    • Anti-FLAG resins for FLAG-tagged constructs

  • Secondary purification:

    • Size exclusion chromatography (SEC) is crucial for removing aggregates and ensuring monodispersity

    • Ion exchange chromatography can provide additional purification based on charge properties

  • Detergent exchange: If necessary, the initial detergent can be exchanged for one more suitable for downstream applications during SEC.

  • Quality assessment:

    • SDS-PAGE and western blotting to confirm identity and purity

    • Analytical SEC to assess monodispersity

    • Thermal stability assays (differential scanning fluorimetry) to optimize buffer conditions

    • Dynamic light scattering to assess homogeneity

For crystallography or cryo-EM studies, consider reconstituting TatC into lipid nanodiscs or amphipols, which better mimic the native membrane environment and often improve protein stability.

How can I assess the functionality of recombinant X. cellulosilytica TatC in vitro?

Assessing the functionality of recombinant TatC requires methods that can probe its ability to bind components of the Tat system and Tat substrates:

  • Substrate binding assays:

    • Isothermal titration calorimetry (ITC) to measure binding affinities between TatC and synthetic signal peptides

    • Microscale thermophoresis (MST) for detecting interactions with minimal protein consumption

    • Surface plasmon resonance (SPR) to assess real-time binding kinetics

  • Complex formation analysis:

    • Blue native PAGE to visualize native-like TatBC complexes

    • Co-immunoprecipitation to detect interactions with TatA and TatB

    • Crosslinking studies followed by mass spectrometry to map interaction interfaces

  • Reconstitution assays:

    • Reconstitute TatC into proteoliposomes with fluorescently labeled Tat substrates

    • Monitor substrate translocation using protease protection assays or fluorescence-based techniques

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

When assessing functionality, it's crucial to include appropriate positive and negative controls, such as known inactive TatC mutants (e.g., those with mutations in conserved residues in the transmembrane helices 5 and 6).

What mutations in TatC affect its functionality and how can they be studied?

Based on research primarily from E. coli TatC, several critical regions and residues have been identified that affect functionality :

RegionCritical ResiduesEffect of MutationExperimental Approach
Polar cluster (TMH5-6)Conserved polar amino acidsDisrupts TatB bindingSite-directed mutagenesis, crosslinking
TMH6 binding siteP221, M222, L225Impairs TatA bindingRandom and targeted mutagenesis, MD simulations
First cytoplasmic loopHighly conserved residuesAffects signal peptide bindingAlanine scanning, in vivo transport assays
TM helix 4Conserved residuesDisrupts oligomerizationDisulfide crosslinking, BN-PAGE

To study these mutations in X. cellulosilytica TatC:

  • Homology mapping: Align X. cellulosilytica TatC with E. coli TatC to identify analogous residues.

  • Mutagenesis approaches:

    • Site-directed mutagenesis for targeted substitutions

    • Random mutagenesis to identify novel functional residues

    • Alanine-scanning mutagenesis of conserved regions

  • Functional assessment:

    • In vivo complementation studies in TatC-deficient strains

    • Transport efficiency measurements using reporter fusion proteins

    • Protein-protein interaction studies using crosslinking or two-hybrid approaches

  • Structural impact analysis:

    • Molecular dynamics simulations to assess conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to detect altered dynamics

    • Thermal stability assays to detect destabilizing mutations

Research has shown that not all mutations that affect binding completely abolish function. For instance, in E. coli, the TatC variants P221R, M222R, and L225P were inactive for protein transport but did not prevent assembly of the Tat receptor complex . This suggests complex relationships between structure and function that warrant detailed investigation.

What structural information is available for TatC proteins and how can it be applied to X. cellulosilytica TatC?

While no specific structural information for X. cellulosilytica TatC is available in the search results, structural data from other bacterial TatC proteins can provide valuable insights:

  • Available structures: Currently, there are crystal structures of TatC from Aquifex aeolicus and structures derived from cryo-EM studies of TatC from other organisms. These structures reveal TatC as a membrane protein with six transmembrane helices arranged in a compact fold.

  • Homology modeling: Using the available structures as templates, a homology model of X. cellulosilytica TatC can be generated using tools such as SWISS-MODEL, Phyre2, or MODELLER. The model should be validated through:

    • Ramachandran plot analysis

    • QMEAN or ProSA Z-scores

    • Comparison of conserved regions across species

  • Structural features to focus on:

    • The cytoplasmic N-terminal region and first cytoplasmic loop, which are involved in signal peptide binding

    • The groove formed between TMH5 and TMH6, which forms the polar cluster binding site for TatA/TatB

    • The second binding site along TMH6, where mutations (P221R, M222R, and L225P in E. coli) affect function without disrupting complex assembly

  • Application to X. cellulosilytica research:

    • Structure-guided mutagenesis to test hypotheses about function

    • Design of peptide inhibitors or modulators of TatC activity

    • Rational design of chimeric TatC proteins to investigate species-specific functions

How can molecular dynamics simulations enhance our understanding of X. cellulosilytica TatC function?

Molecular dynamics (MD) simulations provide powerful tools to investigate the dynamic behavior of membrane proteins like TatC in a lipid environment. For X. cellulosilytica TatC, MD simulations can:

  • Probe conformational dynamics:

    • Identify flexible regions that may facilitate substrate binding or protein-protein interactions

    • Analyze the stability of transmembrane helices in different lipid environments

    • Investigate how mutations affect protein dynamics and stability

  • Characterize binding sites:

    • Map the energetics of TatA and TatB binding to their respective sites on TatC

    • Identify water-accessible cavities that might be involved in substrate recognition

    • Model the interaction with signal peptides to identify key recognition determinants

  • Investigate membrane interactions:

    • Analyze how TatC interacts with and potentially deforms the lipid bilayer

    • Examine the role of specific lipids in stabilizing the protein's conformation

    • Assess the impact of the membrane environment on TatC oligomerization

  • Simulation protocols:

    • All-atom simulations in explicit membrane and solvent (10-100 ns) for detailed interactions

    • Coarse-grained simulations (microseconds) for large-scale conformational changes and oligomerization

    • Enhanced sampling techniques (metadynamics, umbrella sampling) to explore energy landscapes

Research using MD simulations has already provided insights into TatC function, showing how bulky substitutions can reduce TatA binding at the TMH6 site without completely abolishing function . Similar approaches can be applied to X. cellulosilytica TatC to understand its specific structural and functional adaptations.

How does X. cellulosilytica TatC compare to TatC proteins from other bacterial species?

Comparative analysis of TatC proteins across bacterial species reveals important evolutionary insights:

A comprehensive comparative analysis would include generating a multiple sequence alignment of TatC proteins from diverse bacterial phyla, with special focus on other members of the Promicromonosporaceae family to understand the evolutionary context of X. cellulosilytica TatC.

What is known about the tatC gene expression and regulation in X. cellulosilytica?

While specific information about tatC gene expression and regulation in X. cellulosilytica is not directly available in the search results, we can make informed inferences based on the genomic context and knowledge from related bacteria:

  • Genomic context:

    • In most bacteria, tatC is part of an operon that includes tatA and tatB

    • Analysis of the X. cellulosilytica genome (3,831,380 bp with 3,485 protein-coding genes) can reveal the organization of the tat genes

    • The presence of regulatory elements upstream of the tat genes would provide clues about regulation

  • Expression patterns:

    • In many bacteria, basal expression of tat genes is constitutive, reflecting their housekeeping function

    • Environmental stresses (oxidative stress, pH changes, nutrient limitation) often modulate expression

    • Coordinated expression with substrate genes may occur under specific conditions

  • Regulatory mechanisms:

    • Transcriptional regulation: Identify potential binding sites for global regulators in the promoter region

    • Post-transcriptional regulation: Examine the 5' UTR for potential riboswitches or sRNA binding sites

    • Post-translational regulation: Investigate potential phosphorylation or other modification sites

  • Experimental approaches:

    • RT-qPCR to measure tatC expression under different growth conditions

    • RNA-seq to identify co-expressed genes and potential regulatory networks

    • Promoter fusion studies to characterize regulatory elements

    • ChIP-seq to identify transcription factors binding to the tatC promoter region

Understanding tatC regulation in X. cellulosilytica would provide insights into how this organism modulates its protein secretion capacity in response to environmental conditions, particularly those that might require enhanced production of its cellulolytic and xylanolytic enzymes .

How can the study of X. cellulosilytica TatC contribute to biotechnological applications?

X. cellulosilytica's unique combination of cellulolytic/xylanolytic capabilities and the Tat pathway's ability to transport folded proteins presents several biotechnological opportunities:

  • Enhanced enzyme secretion:

    • Engineering the Tat pathway in X. cellulosilytica could enhance secretion of industrial enzymes

    • Optimizing TatC could improve the export efficiency of native cellulases and xylanases

    • The ability to secrete fully folded, active enzymes could reduce downstream processing costs

  • Heterologous protein expression:

    • X. cellulosilytica could be developed as a novel expression host for recombinant proteins

    • The Tat pathway could be engineered to secrete complex proteins that require folding before export

    • Targeting signals derived from X. cellulosilytica Tat substrates could be used to improve heterologous secretion

  • Biomass degradation applications:

    • Enhanced cellulase/xylanase secretion through Tat pathway engineering could improve biomass degradation efficiency

    • Co-expression of complementary enzymes through the Tat pathway could create synergistic activities

    • Surface display of hydrolytic enzymes via modified Tat-dependent translocation could create whole-cell biocatalysts

  • Protein engineering platforms:

    • The Tat quality control mechanism (which typically only transports correctly folded proteins) could be used as a folding reporter in directed evolution experiments

    • Structure-function studies of X. cellulosilytica TatC could inform the design of synthetic protein transport systems

    • Chimeric Tat systems combining components from different organisms could create novel secretion properties

What are the current challenges and future research directions for X. cellulosilytica TatC studies?

Several challenges and promising research directions exist for advancing our understanding of X. cellulosilytica TatC:

  • Technical challenges:

    • Developing genetic tools specific for X. cellulosilytica to enable targeted gene deletions and modifications

    • Optimizing expression and purification of sufficient quantities of functional TatC for structural studies

    • Establishing reliable in vitro reconstitution systems to study Tat-dependent transport mechanistically

  • Knowledge gaps:

    • The complete substrate repertoire of the Tat pathway in X. cellulosilytica remains unknown

    • The detailed molecular mechanism of how TatC recognizes different signal peptides needs clarification

    • The energetics and conformational changes during the transport cycle require further investigation

  • Future research directions:

    • High-resolution structural studies of X. cellulosilytica TatC and the entire TatABC complex

    • Systems biology approaches to understand the integration of the Tat pathway with cellular physiology

    • Comparative studies across multiple species to reveal evolutionary adaptations in the Tat system

    • Development of synthetic biology tools based on the Tat pathway for novel applications

  • Methodological advances:

    • Single-molecule techniques to observe Tat-dependent transport in real-time

    • Cryo-electron tomography to visualize the Tat machinery in its native membrane environment

    • Advanced computational methods to model the complete transport cycle

    • High-throughput screening approaches to identify inhibitors or enhancers of Tat function

Addressing these challenges will require interdisciplinary approaches combining structural biology, biochemistry, molecular biology, and computational modeling to fully understand the structure, function, and application potential of the X. cellulosilytica Tat system and its core component, TatC.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.