Recombinant Xylella fastidiosa DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xylella fastidiosa DNA Translocase FtsK (ftsK)

Recombinant Xylella fastidiosa DNA translocase FtsK is a genetically engineered protein derived from the bacterium Xylella fastidiosa, expressed in Escherichia coli for research applications. This protein belongs to the FtsK/SpoIIIE family, characterized as one of the fastest DNA motor proteins, capable of translocating double-stranded DNA (dsDNA) at rates exceeding 5,000 base pairs per second . Its primary role involves coordinating chromosome segregation with bacterial cell division, particularly in resolving chromosome dimers via activation of XerCD site-specific recombination at the dif site .

Domain Architecture

FtsK consists of three distinct domains:

  1. N-terminal domain: Membrane-spanning region with transmembrane helices, anchoring the protein to the septum during cell division .

  2. Linker domain (L domain): Variable-length cytoplasmic region connecting the N-terminal and C-terminal domains.

  3. C-terminal domain (motor domain): Composed of α, β, and γ subdomains forming a hexameric ring structure.

    • α and β subdomains: Form a RecA-like core with ATPase activity, enabling dsDNA translocation .

    • γ subdomain: Regulates directionality by binding polarized KOPS (GGGNAGGG) sequences, directing translocation toward the chromosome terminus .

Key Functions

FunctionMechanismSource
DNA TranslocationHexameric ring pumps dsDNA through a central channel via ATP hydrolysis.
XerCD-dif Recombination Activationγ subdomain interacts with XerD to catalyze Holliday junction formation.
Chromosome SegregationEnsures topological unlinking of sister chromosomes during cell division.

Expression and Purification of Recombinant FtsK

The recombinant Xylella fastidiosa FtsK is produced as a full-length protein (1–784 amino acids) with an N-terminal His tag for affinity purification. Key specifications include:

ParameterDetailsSource
Expression HostE. coli
TagHis tag (N-terminal)
Purity>90% (SDS-PAGE)
StorageLyophilized powder stored at -20°C/-80°C; reconstituted in sterile water

Biochemical Activity

  • ATPase Activity: Concentration-dependent ATP hydrolysis, critical for DNA translocation .

  • KOPS Binding: Sequence-specific interaction with KOPS motifs directs translocation toward dif sites .

  • XerCD-dif Synergy: Activates XerCD recombination in vitro, generating Holliday junctions for chromosome dimer resolution .

Functional Studies

  • Domain Deletion Mutants: Truncations in the N-terminal or linker domain disrupt nucleoid morphology and membrane architecture, highlighting its role in cell division .

  • Localization Dynamics: FtsK-RFP foci align with FtsZ rings during septum formation, indicating coordinated movement during cell division .

Therapeutic and Diagnostic Potential

  • Pathogenicity Studies: Understanding FtsK’s role in Xylella fastidiosa may inform strategies to disrupt its lifecycle, given its involvement in genome segregation and cell division .

  • Biosensor Development: Recombinant FtsK could serve as a model for studying DNA translocation mechanisms in other bacteria .

Comparative Analysis with Other FtsK Orthologs

FeatureXylella fastidiosa FtsKE. coli FtsKDeinococcus radiodurans FtsK
Chromosome StructureLinear or circular? (Requires clarification)CircularMultipartite genome
KOPS/SRS BindingLikely KOPS-like sequencesGGGNAGGG (KOPS)SRS (GAGAAGGG)
Recombinase ActivationXerCD (inferred)XerCD-difXer-like systems (inferred)
Stress ResponseLimited dataCell division coordinationRadiation recovery dynamics

Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography of Xylella FtsK’s γ domain to map KOPS binding.

  • In Vivo Roles: Investigating FtsK’s interaction with Xylella’s divisome proteins and nucleoid organization.

  • Antimicrobial Targets: Exploring FtsK inhibitors to disrupt Xylella’s survival in plant hosts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ftsK; PD_0670; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-784
Protein Length
full length protein
Species
Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Target Names
ftsK
Target Protein Sequence
MAKQVPERSKPNAGKPSIRKVWSVNGHRLKQHKLLRDLVLIMIAPVLVYLMASLFTYSKD DPGWSQSGSAIVHNIGGKAGAWIADVLFQLCGFVAFLLPVALGVVSWIALFGSDQEEQAE GHLEPALRLVGIVGFLIAATGLFHLHLFQSDVARAGGILGKQVCNSLQAGFGVFGTNLFV LMLLLISVTLATGLSWFALMERIGRVVLAVPPLLQKSKRRADEWQHARALREEREEVRKI DAVQRAKRDPMKIELPPEPIVEKSERAKRDTQIPMFLGVNKRGSDLPSLALLDNPKPQIK GYSDETLEALSRQIELKFKDFRIDVQVVGAYPGPVITRFEIEPARGVKVSQISALDKDIA RGLSVKSVRVVEVIPGKSVIGLEIPNVNREMIFLSELLRSKEYDKSPSSLTLALGKNIAG RPTVADLARMPHLLVAGTTGSGKSVAVNAMVLSLLFKASHNDLRMLMIDPKMLELSVYQG IPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVGVRNLAGFNKKVKDAEEAGQPLMD PLFKPNPDLSEVPRPLQKLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLIL ATQRPSVDVITGLIKANIPTRIAFQVSSKIDSRTILDQSGAETLLGHGDMLYLPPGTAMP ERVHGAFVSDDEVHRVVEYLKASAPVQYVDGVLDEIQTMDDGVVIGPAGFPESASGGGDE TDPLYDEALRIVTETRRASISSVQRRLRIGYNRAARLIEAMETAGVVSPPEHNGDRAVLA PPPR
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the *dif* recombination site, located within the replication terminus region. Translocation halts specifically at Xer-dif sites, where FtsK interacts with the Xer recombinase, enabling the activation of chromosome unlinking through recombination. FtsK orienting polar sequences (KOPS) guide the direction of DNA translocation. FtsK can remove proteins from DNA as it translocates, but translocation stops specifically at the XerCD-dif site, preventing the removal of XerC and XerD from *dif*.
Database Links

KEGG: xft:PD_0670

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Xylella fastidiosa and why is it significant as a research organism?

Xylella fastidiosa is a Gram-negative bacterial plant pathogen with an extremely wide host range, encompassing over 300 different plant species across 63 families. The bacterium has been resolved into distinct subspecies that correlate with host specificity patterns . X. fastidiosa is responsible for numerous economically significant plant diseases, including Pierce's disease in grapevines, citrus variegated chlorosis, almond leaf scorch, and the recently emerging olive quick decline syndrome . As the first plant-pathogenic bacterium to have its genome sequenced, X. fastidiosa represents an important model organism for studying bacterial plant pathogenesis mechanisms, host-pathogen interactions, and bacterial adaptation strategies .

What role does natural competence and DNA recombination play in X. fastidiosa biology?

X. fastidiosa has been demonstrated to be naturally competent, capable of taking up exogenous DNA and incorporating it into its genome through homologous recombination . This natural competence appears to be a significant mechanism contributing to genetic diversity in X. fastidiosa populations. Experimental evidence shows recombination occurring at rates of approximately one in every 10^6 cells when exposed to exogenous plasmid DNA, and one in every 10^7 cells when different strains are grown together in vitro . Multiple factors influence transformation efficiency, including nutrient availability, growth stage, and methylation status of the transforming DNA . The estimated ratio of recombination to point mutations (r/m) in X. fastidiosa is 3.23 at the nucleotide level, suggesting that horizontal gene transfer contributes more significantly to genetic diversity than do point mutations .

How does the FtsK protein typically function in bacterial systems?

While the provided search results don't specifically discuss FtsK in X. fastidiosa, it's important to understand that FtsK is generally a multifunctional protein in bacteria that coordinates cell division with chromosome segregation. In most bacterial systems, FtsK contains an N-terminal domain anchored to the membrane at the division septum and a C-terminal domain with ATP-dependent DNA translocase activity. This translocase activity is crucial for resolving chromosome dimers that form during replication and ensuring proper chromosome segregation before cell division completes. The protein recognizes specific DNA sequences called KOPS (FtsK-orienting polar sequences) that guide its directional movement along the chromosome toward the dif site, where chromosome dimer resolution occurs through site-specific recombination.

What are optimal expression systems for producing recombinant X. fastidiosa proteins?

Based on approaches used for other X. fastidiosa proteins, recombinant expression in Escherichia coli appears to be an effective strategy. For example, the toxin-antitoxin system proteins XfMqsR and XfYgiT from X. fastidiosa were successfully expressed using an E. coli host system . When expressing X. fastidiosa proteins, researchers typically use a two-step chromatography purification process to ensure high purity . For membrane-associated proteins like FtsK, which has transmembrane domains, expression optimization may require:

  • Testing different E. coli expression strains (BL21(DE3), C41(DE3), C43(DE3))

  • Employing solubility-enhancing fusion tags (MBP, SUMO, TrxA)

  • Optimizing induction conditions (temperature, IPTG concentration, induction duration)

  • Using specialized detergents for membrane protein extraction

What purification strategies are most effective for recombinant X. fastidiosa proteins?

For purification of recombinant X. fastidiosa proteins, a multi-step chromatography approach has proven effective. Based on protocols used for other X. fastidiosa proteins, researchers can implement:

  • Initial capture using affinity chromatography (typically Ni-NTA for His-tagged proteins)

  • Secondary purification via size-exclusion chromatography using a Superdex 200 column at a flow rate of 0.4 mL/min

  • Quality assessment using analytical size-exclusion chromatography to determine oligomeric states

  • Verification of purity and structural integrity through analytical ultracentrifugation (AUC)

For FtsK specifically, particular attention should be paid to maintaining the protein's native structure and DNA-binding activity throughout the purification process, potentially requiring the inclusion of stabilizing agents and careful buffer optimization.

How can one verify the structural integrity of purified recombinant FtsK?

Verification of structural integrity for recombinant FtsK can be accomplished through multiple complementary techniques:

  • Analytical size-exclusion chromatography (SEC): This technique helps determine the oligomeric conformation of the protein. Using a Superdex 200 10/300 column with a flow rate of 0.4 mL/min and UV detection at 280 nm can provide insights into the quaternary structure .

  • Analytical ultracentrifugation (AUC): AUC experiments offer detailed information about the sedimentation properties, molecular weight, and shape of the protein .

  • Circular dichroism (CD) spectroscopy: This technique provides data on secondary structure composition, helping verify that the recombinant protein has folded correctly.

  • Thermal stability assays: Similar to the thermostability testing performed for XfMqsR, thermal shift assays can confirm the stability of the recombinant FtsK protein .

  • Functional assays: ATP hydrolysis assays and DNA binding/translocation assays would provide crucial verification that the recombinant FtsK retains its catalytic and DNA-binding activities.

How can researchers study the role of FtsK in X. fastidiosa natural transformation and recombination?

To investigate FtsK's potential role in X. fastidiosa's natural transformation and recombination processes, researchers could employ the following experimental approaches:

  • Gene knockout studies: Generate FtsK deletion or domain-specific mutants in X. fastidiosa using natural transformation with suicide plasmids similar to pAX1-Cm or pKLN61 as described in the literature .

  • Transformation efficiency assays: Compare transformation frequencies between wild-type and FtsK mutant strains using the established protocol where cells are harvested from solid PWG medium, diluted in modified XFM to an OD600 of 0.0025-0.05, grown for 2 days, exposed to exogenous DNA at 5 μg/ml, and then plated on selective media after 24 hours .

  • In vitro DNA translocation assays: Using purified recombinant FtsK, researchers can set up in vitro assays to measure ATP-dependent DNA translocation activity on DNA substrates containing X. fastidiosa chromosome sequences.

  • Fluorescence microscopy: Tagging FtsK with fluorescent proteins to visualize its localization during cell division and potential co-localization with DNA uptake machinery during natural transformation.

  • ChIP-seq analysis: Chromatin immunoprecipitation followed by sequencing could identify FtsK binding sites across the X. fastidiosa genome and potentially reveal involvement in DNA recombination hotspots.

What experimental methods can determine if FtsK contributes to X. fastidiosa virulence and host adaptation?

To assess FtsK's potential contribution to X. fastidiosa virulence and host adaptation, researchers could implement:

  • Plant infection assays: Compare the virulence of wild-type and FtsK mutant strains in various host plants (such as grapevine, citrus, or olive) by measuring disease progression, bacterial population sizes, and symptom development over time.

  • Gene expression analysis: Perform RNA-seq or RT-qPCR to identify genes differentially regulated in FtsK mutants versus wild-type, particularly focusing on known virulence factors.

  • Biofilm formation assays: Given that X. fastidiosa's pathogenicity is linked to biofilm formation in xylem vessels, researchers should quantify biofilm development in FtsK mutants. This approach draws on observations from other X. fastidiosa mutants, such as the finding that mqsR mutations increased biofilm formation in strain Temecula .

  • Comparative genomics: Analyze FtsK sequence conservation and variation across different X. fastidiosa subspecies that exhibit distinct host specificities (X. fastidiosa ssp. fastidiosa, multiplex, and pauca) to identify potential adaptive signatures .

  • In planta transcriptomics: Compare gene expression profiles of wild-type and FtsK mutant strains during plant infection to identify pathways affected by FtsK function that may contribute to virulence.

What approaches can be used to study the enzymatic activity of recombinant X. fastidiosa FtsK?

To characterize the enzymatic activity of recombinant X. fastidiosa FtsK, researchers can employ:

  • ATP hydrolysis assays: Measure the ATPase activity of purified recombinant FtsK in the presence and absence of DNA substrates to determine DNA-dependent ATP hydrolysis rates.

  • DNA translocation assays: Using fluorescently labeled DNA substrates, researchers can monitor FtsK-mediated DNA translocation through techniques such as FRET (Fluorescence Resonance Energy Transfer) or triplex displacement assays.

  • Single-molecule approaches: Techniques such as magnetic tweezers or optical tweezers can provide detailed information about the mechanics and kinetics of FtsK-mediated DNA translocation at the single-molecule level.

  • DNA binding assays: Electrophoretic mobility shift assays (EMSAs) or fluorescence anisotropy measurements can determine the DNA binding specificity and affinity of FtsK, particularly for potential KOPS-like sequences in the X. fastidiosa genome.

  • Site-directed mutagenesis: Introducing specific mutations in the Walker A and Walker B motifs of the ATPase domain can help establish structure-function relationships and identify catalytically important residues.

How does X. fastidiosa FtsK compare to homologs in other bacterial plant pathogens?

While the provided search results don't offer direct comparative information about FtsK across bacterial plant pathogens, a comprehensive analysis would typically include:

  • Sequence analysis: Multiple sequence alignment of FtsK proteins from X. fastidiosa and other plant pathogens (such as Xanthomonas, Ralstonia, Erwinia, and Pseudomonas species) to identify conserved domains and subspecies-specific variations.

  • Domain organization comparison: Analysis of N-terminal (membrane-spanning), linker, and C-terminal (motor and DNA-recognition) domains across different pathogens to identify potential adaptations.

  • Phylogenetic analysis: Construction of phylogenetic trees based on FtsK sequences to understand evolutionary relationships and potential horizontal transfer events.

  • Functional complementation studies: Testing whether FtsK from different bacterial species can complement X. fastidiosa FtsK mutants, and vice versa, to assess functional conservation.

  • KOPS recognition sequence analysis: Identification and comparison of the DNA sequences recognized by FtsK across different bacterial pathogens, as these can vary and may reflect genome-specific adaptations.

What role might FtsK play in the evolution and adaptation of X. fastidiosa subspecies?

Given X. fastidiosa's documented capacity for genetic recombination and its division into subspecies with distinct host specificities , FtsK could play important roles in genomic plasticity and adaptation:

  • Chromosome architecture maintenance: FtsK may contribute to maintaining chromosome organization during the recombination events that occur at relatively high rates in X. fastidiosa populations .

  • Subspecies differentiation: Variations in FtsK function could potentially influence recombination patterns and efficiencies across the different subspecies (fastidiosa, multiplex, pauca), contributing to their divergent evolution and host specialization .

  • Genome stability regulation: As X. fastidiosa adapts to different plant hosts, FtsK may help balance genomic plasticity (beneficial for adaptation) with genomic stability (essential for core cellular functions).

  • Interaction with strain-specific mobile genetic elements: FtsK might interact differently with horizontally acquired DNA elements that are known to contribute significantly to X. fastidiosa genetic diversity .

  • Coordination with subspecies-specific DNA repair systems: Potential variations in how FtsK coordinates with DNA repair machinery could influence mutation rates and recombination patterns across subspecies.

What structural features distinguish X. fastidiosa FtsK from other bacterial translocases?

A comprehensive structural characterization of X. fastidiosa FtsK would typically include:

  • Domain organization analysis: Computational prediction of the membrane-spanning N-terminal domain, linker region, and C-terminal motor domain with DNA-binding specificity.

  • Homology modeling: Construction of three-dimensional models based on crystal structures of FtsK domains from other bacteria (such as E. coli or Pseudomonas aeruginosa).

  • Secondary structure analysis: Similar to the approach used for other X. fastidiosa proteins, techniques like circular dichroism spectroscopy can confirm secondary structure composition .

  • Oligomeric state determination: Analytical size-exclusion chromatography and analytical ultracentrifugation to determine whether X. fastidiosa FtsK forms the hexameric rings typical of this protein family .

  • DNA-binding site characterization: Identification of the specific DNA sequence motifs recognized by X. fastidiosa FtsK, which could be compared with known KOPS sequences from other bacteria.

How can researchers identify potential interacting partners of FtsK in X. fastidiosa?

To identify proteins that interact with FtsK in X. fastidiosa, researchers could employ:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged versions of FtsK expressed in X. fastidiosa to pull down interacting proteins, followed by mass spectrometry identification.

  • Bacterial two-hybrid screening: Testing interactions between FtsK and candidate proteins, particularly those involved in cell division (FtsZ, FtsQ, FtsL), DNA recombination (XerD, XerC), and natural competence machinery.

  • Pull-down assays with recombinant proteins: Similar to the approach used to study the XfMqsR-XfYgiT complex, purified recombinant FtsK could be used in pull-down assays to identify interacting partners .

  • Crosslinking mass spectrometry: In vivo crosslinking followed by mass spectrometry analysis to capture transient interactions under physiological conditions.

  • Fluorescence microscopy co-localization: Fluorescently tagging FtsK and candidate interacting proteins to visualize potential co-localization during different growth stages and conditions in X. fastidiosa cells.

What techniques are most effective for studying the ATPase activity of recombinant X. fastidiosa FtsK?

To characterize the ATPase activity of recombinant X. fastidiosa FtsK, researchers could use:

  • Colorimetric phosphate release assays: Quantifying inorganic phosphate released during ATP hydrolysis using malachite green or other colorimetric reagents.

  • Coupled-enzyme ATPase assays: Using pyruvate kinase and lactate dehydrogenase to couple ATP hydrolysis to NADH oxidation, which can be monitored spectrophotometrically.

  • Radiometric assays: Measuring the conversion of [γ-32P]ATP to [32P]Pi to quantify ATP hydrolysis rates with high sensitivity.

  • Kinetic parameter determination: Establishing Km, Vmax, and kcat values for ATP hydrolysis under various conditions (different DNA substrates, salt concentrations, pH values).

  • Inhibitor studies: Testing the effects of known ATPase inhibitors to characterize the catalytic mechanism and active site properties of X. fastidiosa FtsK.

How might understanding FtsK function contribute to developing strategies for X. fastidiosa disease management?

Understanding FtsK function in X. fastidiosa could contribute to disease management through:

  • Novel antimicrobial targets: If FtsK proves essential for X. fastidiosa viability or virulence, it could represent a potential target for developing specific inhibitors as antimicrobials.

  • Disruption of adaptation mechanisms: If FtsK contributes to genetic adaptation through its role in recombination, targeting this function might reduce the pathogen's ability to adapt to host defenses or environmental conditions.

  • Strain-specific biocontrol approaches: Understanding subspecies differences in FtsK function could inform the development of tailored biocontrol strategies for different X. fastidiosa-caused diseases .

  • Genetic modification of vectors: Knowledge of FtsK's role in X. fastidiosa adaptation could inform strategies to modify insect vectors to reduce bacterial transmission or establishment.

  • Host resistance enhancement: Insights into how FtsK contributes to X. fastidiosa colonization and persistence in plant hosts could guide breeding or engineering of resistant plant varieties.

What methodological advances could improve the study of FtsK in the context of X. fastidiosa natural competence?

To advance understanding of FtsK in X. fastidiosa natural competence, methodological improvements could include:

  • Development of inducible gene expression systems: Creating tools for conditional FtsK expression to study its functions without the complications of lethal phenotypes that might result from complete deletion.

  • Single-cell analysis techniques: Adapting microfluidic and fluorescence microscopy approaches to study natural transformation at the single-cell level, potentially revealing the spatial and temporal dynamics of FtsK during DNA uptake.

  • In situ visualization methods: Developing techniques to visualize DNA translocation in living X. fastidiosa cells, potentially using fluorescently labeled DNA and tagged FtsK protein.

  • High-throughput recombination mapping: Creating methods to precisely map recombination events genome-wide in FtsK wild-type versus mutant strains to identify potential FtsK-influenced recombination hotspots.

  • Improved transformation protocols: Optimization of natural transformation conditions specifically for studying FtsK function, potentially building on the established protocols that identified factors affecting transformation efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.