Recombinant Xylella fastidiosa Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Description

Functional Role in X. fastidiosa

OpgH is integral to OPG biosynthesis, a process with cascading effects on bacterial physiology:

  • Biofilm Regulation: OPGs modulate biofilm architecture by controlling exopolysaccharide (EPS) polymer length. Enzymatic processing of EPS by OpgH-linked pathways attenuates virulence in hosts like grapevines .

  • Virulence Attenuation: Strains lacking EngXCA2 (an endoglucanase that processes OpgH-synthesized glucans) exhibit hypervirulence, indicating OpgH’s indirect role in slowing disease progression .

  • Environmental Adaptation: OPGs stabilize X. fastidiosa under osmotic stress, enhancing survival in xylem vessels and insect vectors .

Enzymatic Activity

  • Substrate Specificity: OpgH synthesizes β-1,2-glucan backbones using UDP-glucose .

  • Mechanism: Structural studies of homologs (e.g., E. coli OpgH) reveal a conserved proton transfer pathway for glycosidic bond cleavage, critical for elongating glucan chains .

Genetic and Phenotypic Insights

Study FocusOutcomeSource
opgH knockout mutantsLoss of OPG production, impaired biofilm formation, and reduced motility PMC6637975
EPS composition analysisOpgH-derived glucans form octasaccharide units with β-1,4-glucan backbones PMC10653819
Hyperosmotic stress responseOpgH expression upregulated under high osmolarity, mediated by LrhA PMC6498166

Applications in Research

  • Pathogenicity Studies: Used to dissect mechanisms of virulence attenuation in symptomatic hosts (e.g., grapevines) .

  • Enzyme Engineering: Serves as a template for modifying OPG biosynthesis in biocontrol strategies .

  • Structural Biology: Recombinant OpgH aids in crystallography studies to map catalytic sites .

Comparative Analysis with Homologs

FeatureX. fastidiosa OpgHE. coli OpgH
Primary Functionβ-1,2-glucan synthesis for OPGsβ-1,2-glucan synthesis for OPGs
Regulatory RoleModulates EPS length and biofilmLinks cell size to nutrient status
Structural MotifsConserved glucosyltransferase domainsSimilar domains with divergent loop regions

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
opgH; mdoH; PD_1156; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-638
Protein Length
full length protein
Species
Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Target Names
opgH
Target Protein Sequence
MQALMEMQIGASEVVQVLDTGCAVLPPESPLPMPEQSLRKGRLHVPRQRTAPLGIGLRRF YLIGGTMSMSLIATWVMLAVMWPGGINVLEGCLLVLFMFLFAWVTMSFASALAGFFCMVF GGGRKLGIDPQMPLPDLHTYTALLVPTYQEDPCRLLAGLQAIYESLSETGQLEHFEFFVL SDSRREEFGLAEEREYAALCERLGAHGRIFYRRRADNTGRKAGNIADWVRRFGGAYQQML ILDADSVMTGDTVVRLVAAMESNPDVGLIQSLPVVVGGRTLFARMQQFGACVYGPIIAYG VAWWHGAESNYWGHNAVIRTKAFADHAGLPALPGRKPFGGHVLSHDFVEAALIRRGGWAT HMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKIVTAAGLHWISRMHMLIGIGHYFT APMWGLLMLVGIAIPLVGDGIDLTAGMHFSPAHYWHGRTDGDVLWIFTFTMFVLLAPKLL AYFALLFKPYERRACGGALRVLLSILLESILAALMAPIVMYLQSRGVFEVLAGKDSGWDA QQRDDGKLSWSVLLRSYGGLSVLGVLIGALAYTVSPPLAMWMSPVVLGMAFSVPVVALTS HRLVGAVLRRWGIFLIPEETAPSKVLIRVAELRRARQP
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Database Links

KEGG: xft:PD_1156

Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Xylella fastidiosa Glucans Biosynthesis Glucosyltransferase H (opgH) and what is its biological function?

Xylella fastidiosa Glucans biosynthesis glucosyltransferase H (opgH) is a key enzyme involved in the synthesis of osmoregulated periplasmic glucans (OPGs) in this bacterial plant pathogen. The protein is encoded by the opgH gene, which works in conjunction with opgG as part of the opgGH operon. This enzyme plays a critical role in bacterial adaptation to osmotic stress, which is essential for bacterial growth and survival in changing environments. OPGs produced through opgH activity function as signaling molecules that control several physiological processes including motility, biofilm formation, and host colonization capabilities of X. fastidiosa and other Gram-negative bacteria .

Methodologically, researchers investigating opgH function often employ gene deletion studies followed by phenotypic characterization to understand the biological impact of this enzyme. These approaches have revealed that opgH contributes significantly to bacterial osmoregulation mechanisms that help bacteria sense and adapt to environmental changes.

What is the structural characterization of recombinant X. fastidiosa opgH protein?

The full-length X. fastidiosa opgH protein (Q87CC5) consists of 638 amino acids. The amino acid sequence includes multiple transmembrane domains and catalytic regions typical of glycosyltransferases. The protein can be recombinantly expressed with an N-terminal His-tag to facilitate purification and functional studies .

For structural studies, researchers typically purify the recombinant protein expressed in E. coli systems and subject it to various biophysical techniques. The protein is commonly stored as a lyophilized powder in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability. When reconstituting the protein, researchers recommend using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL and adding 5-50% glycerol for long-term storage at -20°C/-80°C .

What are the optimal conditions for expressing and purifying recombinant X. fastidiosa opgH protein?

For optimal expression and purification of recombinant X. fastidiosa opgH protein, the following methodological approach is recommended:

Expression System:

  • E. coli expression systems are most commonly used, with BL21(DE3) strains showing good productivity for this protein .

  • Expression vectors containing an N-terminal His-tag facilitate efficient purification using affinity chromatography.

  • Induction conditions typically involve IPTG at 0.5-1.0 mM when bacterial culture reaches OD600 of 0.6-0.8, followed by incubation at 16-18°C overnight to reduce inclusion body formation.

Purification Protocol:

  • Bacterial cell lysis using sonication or French press in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and protease inhibitors

  • Affinity chromatography using Ni-NTA resin

  • Size-exclusion chromatography to enhance purity

  • Final purity should exceed 90% as determined by SDS-PAGE

Storage Considerations:

  • Lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Aliquoting and storage at -20°C/-80°C is essential to avoid repeated freeze-thaw cycles

  • Addition of 50% glycerol (final concentration) for samples requiring longer-term storage

How can researchers assess the enzymatic activity of opgH in laboratory settings?

Researchers can assess opgH enzymatic activity through several complementary approaches:

Direct Enzymatic Assays:

  • Substrate utilization assays measuring the incorporation of radiolabeled UDP-glucose into glucan products

  • HPLC-based detection of reaction products

  • Coupled enzyme assays that monitor either UDP release or glucose incorporation

Functional Assessment Methods:

  • Quantification of OPG production in wild-type versus opgH knockout bacteria using extraction protocols followed by anthrone reagent colorimetric measurement

  • Complementation studies where researchers can assess if the recombinant protein restores OPG production in opgH-deficient mutants

In Vivo Reporter Studies:

  • Construction of chromosomal POpgGH::lacZ fusion reporters to monitor transcriptional activity

  • Measurement of β-galactosidase activity as a proxy for opgH expression under various conditions

When performing these assays, it's critical to include appropriate controls and standardize conditions, particularly with respect to osmolarity, as opgH activity is osmoregulated.

How does opgH activity influence Xylella fastidiosa pathogenicity and transmission by insect vectors?

The influence of opgH activity on X. fastidiosa pathogenicity and vector transmission involves complex interactions between OPG production, biofilm formation, and bacterial motility:

Vector Colonization:
X. fastidiosa colonizes the foregut, specifically the precibarium, of sharpshooter leafhopper vectors like Graphocephala atropunctata. Studies have demonstrated that the presence of bacteria in the precibarium is highly correlated with successful transmission to plants. The bacterial cells attach polarly to the insect's cuticle in a regular pattern throughout the precibarium after long acquisition periods, suggesting a well-regulated colonization process .

Regulatory Pathway Impact:
The opgH-dependent production of OPGs modulates the Rcs phosphorelay system, a key regulatory pathway controlling bacterial surface structures. Research using Phos-tag retardation gel approaches has shown that OPGs control RcsCD-RcsB activation in a concentration-dependent manner. Wild-type bacteria typically maintain high levels of phosphorylated RcsB (84%), while opgH mutants show significantly decreased RcsB phosphorylation (36%) .

Effects on Transmission Efficiency:
The regulation of biofilm formation versus motility, partly controlled by opgH-produced OPGs, affects how efficiently X. fastidiosa can:

  • Establish itself within vector insects

  • Detach during feeding to initiate plant infection

  • Move systematically through plant xylem vessels

Research approaches to study these relationships typically involve comparative transmission experiments using wild-type and opgH mutant bacteria, combined with microscopic examination of vector colonization patterns.

What is the relationship between osmotic stress, opgH regulation, and the LrhA-OmpR regulatory network?

The relationship between osmotic stress, opgH regulation, and the LrhA-OmpR regulatory network represents a sophisticated bacterial adaptation mechanism:

Regulatory Hierarchy:
The following regulatory cascade has been established:

  • Environmental osmolarity changes are sensed by the EnvZ-OmpR two-component system

  • OmpR directly binds to the lrhA promoter and enhances its expression

  • LrhA acts as an osmoregulated transcription factor that directly binds to the opgGH promoter

  • This binding increases opgGH expression and consequently OPG production

  • OPG levels in turn influence the Rcs phosphorelay system activation

Feedback Mechanisms:
Interestingly, the system includes a feedback inhibition mechanism where lrhA expression is inhibited by the activated Rcs phosphorelay system, creating a regulatory circuit that maintains homeostasis .

Experimental Data on Regulation:
Electrophoretic mobility shift assays (EMSAs) have demonstrated that purified His6-LrhA protein binds specifically to the opgGH promoter region (positions -1 to -346) in vitro. Additionally, deletion of lrhA significantly reduces opgGH promoter activity, which can be fully restored by complementation, as measured using chromosomal POpgGH::lacZ fusion reporter analysis .

This relationship explains how bacteria like X. fastidiosa can sense environmental conditions and appropriately switch between motile lifestyles (favorable for transmission) and biofilm lifestyles (favorable for colonization).

What are the best approaches for studying opgH mutants and their phenotypes in X. fastidiosa?

Researchers studying opgH mutants and their phenotypes in X. fastidiosa should consider the following comprehensive approach:

Generation of Genetic Mutants:

  • Allelic exchange mutagenesis using suicide vectors

  • CRISPR-Cas9 genome editing

  • Complementation with wild-type opgH on plasmids or in trans chromosomal insertions

Phenotypic Characterization Techniques:

  • Motility Assays: Measurement of bacterial movement on semi-solid media (0.3-0.5% agar)

  • Biofilm Quantification: Crystal violet staining and spectrophotometric measurement

  • Microscopy Analysis:

    • Scanning electron microscopy (SEM) to observe cell attachment patterns

    • Confocal microscopy with fluorescent dyes to analyze biofilm architecture

  • Root/Plant Colonization: Quantitative recovery of bacteria from infected tissues using selective media

Molecular Characterization:

  • OPG Quantification: Extraction of periplasmic contents followed by anthrone-sulfuric acid colorimetric assay

  • RcsB Phosphorylation Analysis: Phos-tag retardation gel electrophoresis to separate phosphorylated from non-phosphorylated RcsB

  • Gene Expression Studies: RT-qPCR and RNA-seq to identify affected downstream genes

Vector Transmission Studies:

  • Controlled acquisition access periods (AAP) using infected plants

  • Inoculation access periods (IAP) on healthy test plants

  • PCR detection of X. fastidiosa in plant tissue

  • Microscopic examination of bacterial colonization in vector foreguts

The combination of these approaches provides a comprehensive understanding of opgH's role in X. fastidiosa biology and pathogenesis.

How do OPG concentration changes affect the RcsCD-RcsB phosphorelay system and bacterial phenotypes?

The relationship between OPG concentration and RcsCD-RcsB phosphorelay activation represents a sophisticated bacterial signaling system with significant phenotypic consequences:

Concentration-Dependent Activation:
Research has demonstrated that OPG levels directly influence the phosphorylation status of RcsB, with different consequences at varying concentrations. The following table summarizes this relationship based on experimental data:

OPG ConcentrationRcsB PhosphorylationPhenotypic Effects
High (Wild-type)84% RcsB-P, 16% RcsBEnhanced EPS synthesis, Reduced motility, Increased biofilm formation
Low (ΔopgH mutant)36% RcsB-P, 64% RcsBDecreased EPS synthesis, Increased motility, Reduced biofilm formation
Low (ΔlrhA mutant)Significantly reduced RcsB-PSimilar to ΔopgH but less severe effects

Methodological Analysis:
To study this relationship, researchers use:

  • Phos-tag retardation gel electrophoresis to separate and quantify phosphorylated versus non-phosphorylated RcsB

  • Complementation studies where opgH is expressed under inducible promoters to create various OPG concentration states

  • Reporter gene fusions to monitor activation of RcsB-dependent gene expression

Osmolarity Influence:
High medium osmolarity induces increased OPG production, which maintains high-level activation of the Rcs phosphorelay. This activation results in enhanced exopolysaccharide (EPS) synthesis and decreased motility, demonstrating how environmental signals can trigger specific bacterial lifestyle changes through this concentration-dependent mechanism .

What are the promising research gaps in understanding opgH regulation and function in X. fastidiosa?

Several significant research gaps remain in understanding opgH regulation and function in X. fastidiosa:

Structural-Functional Relationships:
While the amino acid sequence of opgH is known, detailed crystal structure analysis of the protein has not been reported. Future research should aim to resolve the three-dimensional structure of opgH to better understand its catalytic mechanism and substrate specificity.

Regulation During Host Infection:
The temporal and spatial regulation of opgH expression during the infection cycle in plants remains poorly characterized. Research monitoring opgH expression in planta at different infection stages would provide valuable insights into its role during pathogenesis.

Vector-Specific Interactions:
How opgH-dependent OPG production specifically influences colonization of different vector species requires further investigation. Comparative studies between efficient vectors like G. atropunctata and less efficient ones like H. coagulata could reveal important determinants of vector specificity .

Cross-Talk with Other Signaling Systems:
While interactions with the Rcs system are documented, potential cross-talk between opgH-dependent signaling and other bacterial regulatory systems (such as c-di-GMP signaling) represents an important research frontier.

Host-Specific Adaptations:
X. fastidiosa infects multiple plant species with different symptom expressions. Whether opgH function or regulation varies depending on the host plant being colonized remains to be determined.

What potential does targeting opgH have for developing novel control strategies against X. fastidiosa diseases?

Targeting opgH presents several promising avenues for developing control strategies against X. fastidiosa diseases:

Inhibitor Development:
The enzymatic nature of opgH makes it an attractive target for small molecule inhibitors. Researchers could:

  • Perform high-throughput screening of chemical libraries against purified recombinant opgH

  • Design rational inhibitors based on substrate analogs

  • Apply structure-based drug design if crystal structures become available

Vector Transmission Disruption:
Since opgH-dependent OPG production influences bacterial attachment and colonization in vector insects, treatments that disrupt this process could inhibit transmission. Research could focus on:

  • Identifying small molecules that prevent X. fastidiosa attachment to the precibarium

  • Developing transgenic plants that express inhibitors affecting opgH function when ingested by vectors

Biofilm Regulation:
Manipulating opgH function could potentially control the transition between biofilm and planktonic lifestyles. This approach might:

  • Induce a motile state that prevents stable colonization

  • Combine with other antimicrobial strategies to target bacteria in a more susceptible state

Genetic Approaches:
The essential nature of opgH for pathogen virulence makes it a candidate for:

  • Developing attenuated strains for cross-protection

  • RNA interference-based approaches delivered through transgenic plants or vectors

Resistance Breeding:
Understanding how opgH contributes to virulence could inform resistance breeding programs by:

  • Identifying plant factors that interfere with opgH function

  • Developing molecular markers associated with reduced susceptibility to infection

The development of these control strategies requires further research to fully characterize the function and regulation of opgH in X. fastidiosa under various environmental conditions and in different host contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.