Recombinant Xylella fastidiosa Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
msbA; PD_0361; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Target Names
msbA
Target Protein Sequence
MNVLSGAMRYATPWRTYRRLLSYAREYRWLLVVAACGALLEAVAGSTFLALMKPITNETF IERNREVALWLPLGIVGLFLLRGIAGYITDMAMGRAARSIARDFRVCVLTKYFRLPGSRF DGEPVASMLVRLGSDSEQVAHAVIDAMKVMVQQTLQVIGALVVMLWYSWTVTLAILLVAP LLAWVMQRVAKRYRRISHHIQESNAQLMQAADQALSNYQDVKVYAAQESELERYARLANI NLGLAVKVESTRSISSAAVQLLGAVGLAMLLLIAGHEALAGRLSPGDFVSLMTSMIAVIP ALKQLTNVQNMLQSGIASAQRLFSVLDSPDELDTGRRPLGRARGLIEFRGITARYPGRSA PVLDSVSFVAAPGTVTAIVGRSGSGKSSLIKLIPRFYEPESGQILLDGHPLQDYLLADLR RQIALVGQQVMLFDGSIADNIAYGEMRQVVSEEIERVVVDANAQDFVNQLPEGLQFQVGV KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALQRLMPERTTLVIA HRLSTIKHADQVLVMDQGRIIESGTHVDLLARDGLYAYLYSMQFRERPT
Uniprot No.

Target Background

Function
MsbA, the Lipid A export ATP-binding/permease protein, plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: xft:PD_0361

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Xylella fastidiosa and why is it significant for research?

Xylella fastidiosa is an economically important bacterial plant pathogen that causes significant agricultural losses worldwide. Once believed to be limited to the Americas, it has recently emerged in other regions. The bacterium is vector-borne and has multiple subspecies with distinct evolutionary trajectories, including X. fastidiosa subsp. fastidiosa, multiplex, pauca, morus, and sandyi . The significance of X. fastidiosa for research lies in its genomic diversity, recombination capability, and its role as a model system for understanding bacterial plant pathogens. Studies of this organism provide insights into pathogen evolution, host-pathogen interactions, and potential control mechanisms for economically devastating plant diseases .

What is the function of MsbA in gram-negative bacteria like Xylella fastidiosa?

MsbA functions as an essential ATP-binding cassette (ABC) transporter in gram-negative bacteria, including Xylella fastidiosa. Its primary role is to transport lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This transport process, often described as a "flipping" mechanism, is critical for the proper assembly of the bacterial outer membrane, which serves as a protective barrier against environmental stresses and antimicrobial compounds. The functioning of MsbA is ATP-dependent, with the protein undergoing conformational changes during the transport cycle. Structural studies, such as those conducted on Salmonella typhimurium MsbA at 2.8 Å resolution, have revealed that the protein can adopt multiple conformations, including inward-facing states that create a transmembrane portal large enough to accommodate lipid A molecules .

How does genomic diversity contribute to Xylella fastidiosa pathogenicity?

Genomic diversity in Xylella fastidiosa plays a crucial role in its pathogenicity through several mechanisms. First, the bacterial species is divided into subspecies with different host ranges and virulence profiles, which is reflected in their genomic composition. Second, recombination serves as a major driver of diversity in X. fastidiosa, allowing for the acquisition and exchange of genetic material that can confer adaptive advantages .

Research using 72 genomes has demonstrated that each of the main subspecies is under different selective pressures, which has led to the evolution of distinct accessory genomes that may contain virulence factors specific to certain host plants . The core genome of X. fastidiosa also shows evidence of genes under positive selection, suggesting adaptive evolution in response to environmental challenges. The evolutionary rate of the species has been estimated at 7.62 × 10⁻⁷ substitutions per site per year for the core genome, providing insights into how rapidly the pathogen can evolve new traits .

How does homologous recombination occur in Xylella fastidiosa?

Homologous recombination in Xylella fastidiosa occurs through natural competence, a process where the bacterium can take up DNA from its environment and incorporate it into its genome. This mechanism has been demonstrated in laboratory settings through co-culturing experiments using combinations of live or heat-killed donor strains with live recipient strains .

The process typically involves:

  • DNA uptake by naturally competent recipient cells

  • Homologous pairing between the incoming DNA and recipient genome

  • Exchange of genetic material through crossover events

  • Selection and fixation of recombinant sequences

In experimental settings, recombination events can be tracked using antibiotic resistance markers. When donor DNA containing such markers is taken up by recipient cells, successful recombination results in antibiotic-resistant transformants that can be selected and further analyzed. Subsequent genome sequencing reveals the extent of DNA exchange beyond the marker regions, providing insights into the recombination process at the genome-wide level .

What patterns characterize inter- versus intrasubspecific recombination in Xylella fastidiosa?

Research has revealed distinct patterns between inter- and intrasubspecific recombination in Xylella fastidiosa:

Intersubspecific recombination (between different subspecies):
When X. fastidiosa subsp. multiplex strain AlmaEM3 was used as a donor and X. fastidiosa subsp. fastidiosa strain TemeculaL as a recipient, recombination was limited to regions flanking the selection marker. In specific recombinants, the exchanged regions were relatively small, with one showing a 10-kb region (spanning five recombination events) and another showing only a 3.5-kb region (spanning one recombination event) .

Intrasubspecific recombination (within the same subspecies):
When recombination occurs between strains of the same subspecies, the pattern appears to be different. In these cases, recombination may occur at multiple locations across the genome, not just around selection markers. This suggests that genetic similarity between donor and recipient facilitates more extensive DNA exchange .

These differences in recombination patterns may reflect:

  • Sequence divergence barriers that limit recombination between distantly related strains

  • Subspecies-specific restriction-modification systems that protect against foreign DNA

  • Differences in natural competence efficiency between subspecies

How do researchers identify and characterize recombination events in X. fastidiosa genomes?

Researchers employ several complementary approaches to identify and characterize recombination events in X. fastidiosa genomes:

  • Reference mapping and alignment: Sequencing reads from recombinant strains are mapped to parental strain genomes to identify regions with evidence of DNA exchange . This approach provides initial insights into the location and extent of recombination events.

  • Clustering algorithms: Tools like hierBAPS (Hierarchical Bayesian Analysis of Population Structure) are used to classify strains into genetic clusters, which helps identify potential recombinants that show mixed ancestry .

  • Specialized recombination detection software: Programs such as fastGEAR and BratNextGen apply statistical methods to identify recombination events with high confidence. These tools can detect both recent and ancestral recombination events across whole genomes .

  • Comparative genomics: By comparing the accessory genomes of different subspecies, researchers can identify genes that may have been acquired through horizontal gene transfer and subsequent recombination .

  • Molecular dating approaches: These methods, such as those implemented in BEAST (Bayesian Evolutionary Analysis Sampling Trees), can estimate the timing of recombination events by calculating evolutionary rates and divergence times .

What structural conformations has MsbA been observed to adopt, and how do they relate to its function?

MsbA has been observed to adopt several distinct conformations that reflect different stages of its transport cycle:

  • Inward-facing conformation: This conformation, observed in the X-ray structure of MsbA from Salmonella typhimurium at 2.8 Å resolution, features a large amplitude opening in the transmembrane portal. This opening is likely required for lipid A to enter the protein-enclosed transport pathway from its site of synthesis . In this state, the nucleotide-binding domains (NBDs) are separated.

  • Occluded conformation: An intermediate state where the substrate is enclosed within the transporter, but neither exposed to the cytoplasmic nor periplasmic sides of the membrane.

  • Outward-facing conformation: In this state, the NBDs come together upon ATP binding, causing the transmembrane domains to open toward the periplasmic side, allowing for the release of lipid A into the outer leaflet of the inner membrane.

These conformational changes support a "trap and flip" model of lipid A transport, where MsbA binds lipid A on the cytoplasmic side, undergoes a conformational change upon ATP binding, and releases lipid A on the periplasmic side. Electron density attributed to lipid A has been observed at different locations within MsbA structures, including inside the transmembrane cavity and near an outer surface cleft at the periplasmic ends of the transmembrane helices .

The physiological relevance of the most wide-open inward-facing conformer, observed in a previous lower-resolution (5.3 Å) X-ray structure (PDB 3B5W), has been debated in the field . More recent higher-resolution structures provide valuable insights into the actual conformational states relevant to the transport mechanism.

How does ATP binding and hydrolysis drive the transport cycle of MsbA?

ATP binding and hydrolysis drive the MsbA transport cycle through a coordinated series of conformational changes:

  • ATP binding: When ATP binds to the nucleotide-binding domains (NBDs) of MsbA, it causes these domains to dimerize. This dimerization induces conformational changes in the transmembrane domains, transitioning the protein from an inward-facing to an outward-facing conformation.

  • Lipid A movement: The conformational change helps "flip" the lipid A substrate from the inner leaflet to the outer leaflet of the inner membrane.

  • ATP hydrolysis: Hydrolysis of ATP provides the energy to reset the transporter to its inward-facing conformation, preparing it for another transport cycle.

  • ADP and Pi release: The release of ADP and inorganic phosphate completes the cycle.

What evolutionary insights can be gained from comparing MsbA across different bacterial species?

Comparing MsbA across different bacterial species provides several evolutionary insights:

  • Conservation of essential function: As an ABC transporter responsible for lipid A/LPS transport, MsbA is essential in gram-negative bacteria, and its core functional domains show high conservation across species.

  • Adaptation to different LPS structures: Different bacterial species produce lipid A and LPS with varying structures and compositions. Comparative analysis of MsbA proteins reveals adaptations in substrate-binding regions that accommodate these species-specific differences.

  • Selective pressures: By analyzing the rates of synonymous versus non-synonymous substitutions in MsbA sequences, researchers can identify regions under purifying selection (highly conserved) versus those under diversifying selection (more variable).

  • Horizontal gene transfer: In some cases, MsbA variants might be acquired through horizontal gene transfer, particularly in bacteria that undergo extensive recombination like Xylella fastidiosa.

The evolutionary rate estimated for X. fastidiosa's core genome (7.62 × 10⁻⁷ substitutions per site per year) provides a framework for understanding the pace of MsbA evolution within this species. Comparing this rate with other bacterial transporters can reveal whether MsbA is evolving faster or slower than other genes, potentially indicating its importance for bacterial fitness and adaptation.

What expression systems are most effective for producing recombinant X. fastidiosa MsbA protein?

Based on existing research practices for membrane proteins like MsbA, several expression systems have proven effective:

  • E. coli overexpression systems: Using specialized E. coli strains like C41(DE3) or C43(DE3), which are engineered for membrane protein expression, researchers can achieve good yields of functional MsbA protein. These systems typically employ vectors with inducible promoters like T7 or arabinose-inducible promoters.

  • Insect cell expression: Baculovirus-infected insect cells (Sf9 or Hi5) provide a eukaryotic expression environment that can support proper folding and post-translational modifications of complex membrane proteins.

  • Cell-free expression systems: These can be particularly useful for toxic membrane proteins and allow for the direct incorporation of the protein into nanodiscs or liposomes.

For X. fastidiosa MsbA specifically, the expression system should be optimized considering:

  • Codon optimization for the host system

  • Addition of purification tags (e.g., His-tag, FLAG-tag) that minimally impact function

  • Use of fusion partners that enhance solubility or membrane integration

  • Temperature and induction conditions that maximize properly folded protein yield

The choice of detergent for extraction and purification is also critical, with mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) often providing the best balance between efficient extraction and preservation of protein structure and function.

What are the most reliable methods for assessing MsbA transport activity in vitro?

Several robust methods have been developed to assess MsbA transport activity in vitro:

  • ATPase activity assays: These measure the rate of ATP hydrolysis by purified MsbA, which correlates with transport function. Methods include:

    • Colorimetric phosphate release assays (malachite green)

    • Coupled enzyme assays (linking ATP hydrolysis to NADH oxidation)

    • Radioactive [γ-³²P]ATP hydrolysis assays

  • Fluorescence-based transport assays: Using fluorescent lipid analogues or environmentally sensitive probes to monitor:

    • Lipid flipping across proteoliposome membranes

    • Conformational changes during the transport cycle

  • Reconstituted systems: MsbA can be reconstituted into:

    • Proteoliposomes for direct transport measurements

    • Nanodiscs for structural and functional studies

    • Lipid bilayer systems for electrophysiological measurements

  • Binding assays: Techniques to measure substrate binding include:

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Fluorescence polarization with labeled lipid A

  • Structural assessment: Correlating function with structure using:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Electron paramagnetic resonance (EPR) spectroscopy

    • Single-molecule FRET to observe conformational dynamics

The most informative approach often combines multiple methods to correlate ATP hydrolysis rates with actual lipid transport, while monitoring conformational changes that occur during the transport cycle.

How can researchers effectively study recombination events involving the msbA gene in X. fastidiosa?

Researchers can employ several strategies to study recombination events involving the msbA gene in X. fastidiosa:

  • In vitro natural transformation experiments:

    • Co-culture combinations of donor and recipient X. fastidiosa strains

    • Use antibiotic resistance markers linked to the msbA gene for selection

    • Generate recombinant strains and analyze the extent of DNA exchange

  • Genome sequencing and comparative analysis:

    • Whole-genome sequencing of parental and recombinant strains

    • Reference mapping of reads to identify recombinogenic regions

    • Alignment of contigs to parental strain genomes to visualize recombination events

  • Specialized recombination detection tools:

    • Apply algorithms like fastGEAR and BratNextGen for statistical identification of recombination

    • Use clustering tools like hierBAPS to classify strains into genetic clusters and identify potential recombinants

  • Gene-specific approaches:

    • PCR amplification and sequencing of msbA from multiple strains

    • MLST (Multi-Locus Sequence Typing) including msbA as one of the loci

    • Construction of phylogenetic trees specific to msbA compared to whole-genome phylogenies

  • Experimental evolution:

    • Subject X. fastidiosa populations to selective pressures that might affect msbA function

    • Monitor for recombination events over multiple generations

    • Sequence msbA regions before and after selection

When studying recombination involving msbA specifically, researchers should consider its essential nature and the potential biological consequences of recombination events in this gene, which might affect lipid A transport, membrane integrity, and possibly antibiotic resistance.

How do subspecies-specific variations in MsbA affect lipid A transport and bacterial fitness?

This advanced question addresses the functional consequences of evolutionary divergence in MsbA across X. fastidiosa subspecies:

The MsbA protein may vary between subspecies of X. fastidiosa (fastidiosa, multiplex, pauca, morus, and sandyi), reflecting adaptation to different plant hosts and environmental conditions. These variations might affect:

  • Transport efficiency: Subspecies-specific MsbA variants could differ in their ATP hydrolysis rates, substrate binding affinities, or conformational dynamics, leading to differences in lipid A transport efficiency.

  • Substrate specificity: Different subspecies might produce slightly different lipid A structures that require adapted MsbA proteins for optimal transport.

  • Stress tolerance: Variations in MsbA could influence how well different subspecies cope with environmental stresses like temperature fluctuations, pH changes, or presence of antimicrobial compounds.

  • Host adaptation: Since the outer membrane is the interface with the host, MsbA-mediated differences in LPS presentation might affect host recognition and immune response evasion.

Research approaches to address this question include:

  • Comparative structural modeling of MsbA variants from different subspecies

  • Expression and functional characterization of recombinant MsbA proteins

  • Creation of chimeric MsbA proteins to identify regions responsible for functional differences

  • Competition assays between strains with native versus heterologous MsbA under various conditions

What role does recombination play in the evolution of antibiotic resistance involving MsbA in X. fastidiosa?

While X. fastidiosa is a plant pathogen, understanding the relationship between recombination, MsbA, and antibiotic resistance has important implications:

  • MsbA as an antibiotic resistance determinant: As a lipid A/LPS transporter, MsbA can influence susceptibility to various antibiotics, particularly those targeting the outer membrane. Mutations or recombination events that alter MsbA structure or expression could potentially modulate antibiotic resistance.

  • Recombination as an accelerator of resistance evolution: The high rates of homologous recombination observed in X. fastidiosa could accelerate the spread of beneficial mutations in msbA that confer resistance advantages.

  • Transfer of resistance determinants: Recombination might facilitate the transfer of genetic elements between strains that alter MsbA function or regulation, potentially conferring resistance phenotypes.

  • Co-transfer of resistance genes: Recombination events involving msbA might co-transfer nearby genes that directly confer antibiotic resistance.

Experimental approaches to investigate this question include:

  • Selection experiments with antibiotics to identify resistant variants

  • Genome sequencing of resistant isolates to detect recombination events

  • Directed evolution of msbA under antibiotic selection

  • Structure-function studies of MsbA variants from resistant strains

How do environmental factors influence recombination rates affecting the msbA gene in X. fastidiosa populations?

Environmental factors can significantly impact recombination rates in bacteria, with potential implications for the msbA gene:

  • Stress-induced competence: Environmental stressors encountered by X. fastidiosa in different plant hosts or during vector transmission might induce natural competence, increasing recombination rates.

  • Bacterial density effects: Population density, which varies across infection stages and host plants, may affect cell-to-cell contact rates and opportunities for DNA exchange.

  • Host plant chemistry: Different plant hosts contain varying chemical compounds that might enhance or inhibit natural transformation and subsequent recombination.

  • Temperature fluctuations: Seasonal temperature changes or microclimate variations within plants could affect DNA stability, repair mechanisms, and recombination machinery.

  • Biofilm formation: X. fastidiosa forms biofilms in plant xylem vessels, which might create structured environments with heightened opportunities for DNA exchange.

Research strategies to address this question include:

  • Field sampling of X. fastidiosa from different hosts and seasons

  • Laboratory manipulation of environmental conditions followed by recombination rate assessment

  • Transcriptomic analysis of competence genes under different environmental conditions

  • Mathematical modeling of recombination dynamics in fluctuating environments

What are the key challenges in purifying functional MsbA from X. fastidiosa, and how can they be overcome?

Purifying functional membrane proteins like MsbA from X. fastidiosa presents several technical challenges:

  • Low natural abundance: MsbA is typically expressed at low levels in native membranes, necessitating overexpression systems.

  • Slow growth of X. fastidiosa: The bacterium grows slowly in culture, making native protein purification impractical for most applications.

  • Membrane protein stability: Extracting MsbA from its native lipid environment risks destabilization and loss of function.

  • Detergent selection: Different detergents vary in their ability to extract and maintain MsbA in a functional state.

  • Protein aggregation: Purified MsbA may aggregate, particularly at high concentrations needed for structural studies.

Strategies to overcome these challenges include:

  • Heterologous expression: Using well-established systems like E. coli with optimized vectors and induction conditions

  • Detergent screening: Systematic testing of various detergents and lipid additives for optimal stability

  • Nanodiscs or SMALPs: Reconstituting purified MsbA into more native-like membrane environments

  • Thermostability assays: Implementing high-throughput screens to identify conditions promoting protein stability

  • Addition of lipid A during purification: Including substrate analogs that may stabilize specific conformations

  • Protein engineering: Introducing mutations that enhance expression or stability without compromising function

How can researchers effectively correlate structural data with functional insights for X. fastidiosa MsbA?

Correlating structure with function for membrane transporters like MsbA requires integrative approaches:

  • Structure determination in multiple conformational states:

    • X-ray crystallography with various ligands/inhibitors

    • Cryo-EM to capture different states of the transport cycle

    • NMR for dynamic regions and conformational changes

  • Functional validation of structural hypotheses:

    • Site-directed mutagenesis of residues identified in structural studies

    • Cross-linking studies to validate proximity relationships

    • EPR spectroscopy to measure distances between domains during the transport cycle

  • Computational approaches:

    • Molecular dynamics simulations to model conformational changes

    • Ligand docking to predict substrate binding modes

    • Evolutionary coupling analysis to identify co-evolving residues

  • Integrative structural biology:

    • Combining low and high-resolution techniques (SAXS, HDX-MS, XL-MS)

    • Single-molecule approaches to observe individual transport events

    • Native mass spectrometry to analyze protein-lipid interactions

The key is to design experiments where functional measurements can be directly linked to specific structural features or conformational changes. For example, introducing cysteine residues for cross-linking at positions predicted to move during the transport cycle, then measuring how cross-linking affects transport activity.

What bioinformatic tools and pipelines are most appropriate for analyzing recombination events in the X. fastidiosa msbA gene?

Several specialized bioinformatic tools and pipelines are particularly suitable for analyzing recombination events involving the msbA gene in X. fastidiosa:

  • Sequence alignment and phylogenetic analysis:

    • MAFFT or MUSCLE for accurate multiple sequence alignment

    • RAxML or IQ-TREE for maximum likelihood phylogenetic tree construction

    • SplitsTree for visualization of phylogenetic networks showing recombination

  • Recombination detection programs:

    • fastGEAR for detection of recent and ancestral recombination events

    • BratNextGen for stringent recombination detection

    • RDP4 suite (RecombinationDetectionProgram) which implements multiple recombination detection methods

    • GARD (Genetic Algorithm for Recombination Detection) for identifying recombination breakpoints

  • Population structure analysis:

    • hierBAPS for hierarchical Bayesian analysis of population structure

    • Structure software for identifying admixed individuals

    • PopART for visualization of genetic relationships with geographic data

  • Molecular dating and evolutionary rate estimation:

    • BEAST for Bayesian evolutionary analysis and molecular dating

    • ClonalFrameML for reconstructing bacterial genealogies while accounting for recombination

  • Genome-wide analysis tools:

    • Mauve or progressiveMauve for whole-genome alignment and visualization

    • ACT (Artemis Comparison Tool) for pairwise genome comparisons

    • Roary for pan-genome analysis to identify core and accessory genes

A typical analysis pipeline might include:

  • Extracting msbA sequences from multiple X. fastidiosa genomes

  • Performing multiple sequence alignment

  • Constructing phylogenetic trees and networks

  • Applying multiple recombination detection methods

  • Validating predicted recombination events through simulation or experimental approaches

How might CRISPR-Cas9 genome editing advance our understanding of MsbA function in X. fastidiosa?

CRISPR-Cas9 genome editing technology offers powerful new approaches for studying MsbA function in X. fastidiosa:

  • Precise genetic manipulation:

    • Introduction of point mutations to test structure-function hypotheses

    • Generation of domain swaps between subspecies to identify regions responsible for functional differences

    • Creation of reporter fusions to study MsbA localization and expression

  • Conditional expression systems:

    • Development of inducible msbA expression to study the immediate effects of MsbA depletion

    • Creation of temperature-sensitive alleles for temporal control of MsbA function

    • Promoter replacements to modulate expression levels

  • In vivo studies:

    • Introduction of tagged MsbA variants to study protein-protein interactions in the native context

    • Modification of msbA regulatory regions to understand expression control

    • Engineering of specific recombination hotspots to study msbA transfer between strains

  • High-throughput approaches:

    • CRISPR interference (CRISPRi) screens to identify synthetic genetic interactions with msbA

    • Saturation mutagenesis of msbA to comprehensively map functional residues

    • CRISPR-based activation or repression of genes affecting MsbA function

The development of efficient transformation protocols for X. fastidiosa will be crucial for implementing these approaches. CRISPR-based methods could potentially overcome the current limitations in genetic manipulation of this bacterium, opening new avenues for in vivo functional studies.

What potential exists for developing novel antimicrobials targeting MsbA in X. fastidiosa?

MsbA represents a promising target for developing novel antimicrobials against X. fastidiosa for several reasons:

  • Essential function: As the lipid A/LPS transporter, MsbA is essential for outer membrane biogenesis and bacterial viability.

  • Surface accessibility: Being a membrane protein, MsbA could potentially be targeted by molecules that don't need to cross the cell wall barrier.

  • Unique features: X. fastidiosa MsbA may have species-specific features that could be exploited for selective targeting.

Potential antimicrobial development strategies include:

  • Structure-based drug design:

    • Virtual screening against X. fastidiosa MsbA structural models

    • Fragment-based approaches to identify initial chemical scaffolds

    • Optimization of compounds that interfere with ATP binding or hydrolysis

  • Natural product screening:

    • Testing plant-derived compounds, especially from resistant host plants

    • Exploring compounds produced by microorganisms that compete with X. fastidiosa

  • Peptide inhibitors:

    • Designing peptides that interfere with conformational changes

    • Developing antimicrobial peptides that bind to MsbA and disrupt function

  • Conjugated approaches:

    • Creating compounds that simultaneously target MsbA and deliver antimicrobial payloads

    • Developing targeted phage-based delivery systems for anti-MsbA compounds

  • Alternative delivery mechanisms:

    • Exploring delivery through plant vascular systems

    • Developing vector-mediated delivery strategies

The development of such antimicrobials would require careful consideration of delivery methods in planta, potential effects on beneficial microbiota, and resistance management strategies.

How can systems biology approaches integrate MsbA function with broader X. fastidiosa pathogenicity networks?

Systems biology approaches offer powerful frameworks for understanding how MsbA function integrates with broader pathogenicity networks in X. fastidiosa:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data to understand how MsbA expression correlates with other cellular processes

    • Identifying co-expressed gene networks that include msbA

    • Metabolic modeling to predict the effects of altered MsbA function on cellular physiology

  • Network analysis:

    • Constructing protein-protein interaction networks centered on MsbA

    • Identifying functional modules that include MsbA using graph theory approaches

    • Comparing network architectures across different X. fastidiosa subspecies

  • Flux balance analysis:

    • Developing genome-scale metabolic models that incorporate lipid A biosynthesis and transport

    • Predicting metabolic consequences of altered MsbA function

    • Identifying potential metabolic vulnerabilities linked to MsbA

  • Host-pathogen interaction modeling:

    • Integrating MsbA function with models of plant immune response

    • Simulating how alterations in lipid A presentation affect host recognition

    • Modeling effects of environmental variables on MsbA function and pathogenicity

  • Evolutionary systems biology:

    • Analyzing how recombination events involving msbA propagate through population networks

    • Studying the co-evolution of MsbA with other cellular components

    • Identifying selection signatures across different ecological niches

These integrative approaches can provide a holistic understanding of how MsbA contributes to X. fastidiosa physiology and pathogenicity beyond its immediate role in lipid A transport, potentially revealing unexpected connections and therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.