Recombinant Xylella fastidiosa Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Xylella fastidiosa and Lipoprotein Signal Peptidase

Xylella fastidiosa is a xylem-limited Gram-negative bacterium that causes economically significant diseases in important agricultural crops, most notably Pierce's disease of grapevine . This pathogen depends on insect vectors, particularly spittlebugs like Philaenus spumarius, for transmission between host plants . As of recent research, the host range of Xylella species has expanded to include 563 plant species reported to be infected by X. fastidiosa .

Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is an essential enzyme in gram-negative bacteria that plays a critical role in the processing of prolipoproteins during their maturation pathway . This enzyme specifically cleaves the signal peptide from prolipoproteins after lipid modification, enabling proper localization and function of mature lipoproteins in the bacterial cell envelope.

Recombinant Expression Systems

The recombinant Xylella fastidiosa lspA is produced using a yeast expression system . This eukaryotic expression platform offers several advantages for producing bacterial proteins, including proper protein folding, post-translational modifications, and typically higher yields compared to bacterial expression systems.

Purification and Quality Control

The recombinant protein undergoes purification processes to achieve >85% purity as determined by SDS-PAGE analysis . While specific purification methods aren't detailed in the available literature, typical approaches for recombinant proteins expressed in yeast include affinity chromatography using tagged constructs, ion exchange chromatography, and gel filtration.

Lipoprotein Processing Pathway

Lipoprotein signal peptidases are integral to the bacterial lipoprotein biosynthesis pathway. In this pathway, prolipoproteins undergo a series of post-translational modifications, beginning with lipidation of a conserved cysteine residue by diacylglyceryl transferase. Following lipidation, lspA cleaves the signal peptide to release the mature lipoprotein, which is then properly localized within the bacterial cell envelope.

Role in Bacterial Physiology

While the specific functions of lipoproteins processed by lspA in Xylella fastidiosa have not been explicitly detailed in the provided literature, bacterial lipoproteins typically serve diverse roles including nutrient acquisition, adhesion, colonization, and interactions with host cells. These functions are critical for bacterial survival and pathogenesis.

Connection to Biofilm Formation

Xylella fastidiosa relies on biofilm formation for both plant colonization and insect transmission . The bacterium forms biofilms with different architectures in plant and insect hosts, suggesting active regulation of this process . While direct evidence linking lspA to biofilm formation is not provided in the search results, lipoproteins processed by lspA could potentially be involved in adhesion and biofilm development.

Implications for Host-Pathogen Interactions

Cell-cell signaling plays a crucial role in Xylella fastidiosa interactions with both plant hosts and insect vectors . The bacterium produces a diffusible signaling factor (DSF) regulated by the rpfF gene that affects virulence and transmission . Although the relationship between lspA and these signaling pathways is not explicitly established in the provided literature, bacterial lipoproteins often function in cellular communication and environmental sensing.

Tool for Studying Bacterial Physiology

Recombinant lspA serves as a valuable research tool for studying bacterial protein processing and maturation. By investigating the function of this enzyme, researchers can better understand the fundamental biological processes that underpin Xylella fastidiosa survival and pathogenicity.

Potential for Diagnostics and Detection

Given the growing concern about Xylella fastidiosa spread and its impact on agriculture, proteins unique to this pathogen could serve as targets for diagnostic development. Sensitive detection methods using insect vectors have already shown promise in monitoring and predicting the distribution of Xylella fastidiosa , and specific bacterial proteins or antibodies against them could enhance these approaches.

Potential as an Antimicrobial Target

As an essential enzyme in bacterial physiology, lspA represents a potential target for antimicrobial development. Inhibiting lipoprotein processing could disrupt multiple bacterial functions simultaneously, potentially offering a broad-spectrum approach to controlling Xylella fastidiosa infections.

Integration with Systems Biology Approaches

Understanding the role of lspA within the broader context of Xylella fastidiosa gene regulation networks would provide valuable insights. The bacterium employs complex signaling systems that coordinate gene expression for adaptation to different host environments . Investigating how lipoprotein processing integrates with these regulatory networks could reveal new approaches to disease management.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; XfasM23_1520; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Xylella fastidiosa (strain M23)
Target Names
lspA
Target Protein Sequence
MTRPTHPNALIWLLLSIAIIALDQATKAWVLTSLPEYIPVPVIHGFWNWYRSYNTGAAFS FLSDAGGWQMWLFIALALGISGLLTFWLSRTPRREWRSALPYALIIGGGIGNVIDRFLHG HVVDFIQWYVGSYYWPSFNLADSAIVAGAIGIGLLSLFDSKHSPKTP
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Xylella fastidiosa and why is it important to study?

Xylella fastidiosa is a xylem-limited bacterial plant pathogen that causes serious diseases in agricultural crops globally. It exhibits significant strain variability regarding virulence on specific host plant species, and natural competence and horizontal gene transfer frequently occur in this pathogen, influencing its evolution . As a species, X. fastidiosa can infect many host plants, but specific strains show host specialization. It is primarily transmitted by insect vectors, which is crucial for its disease cycle . Economic impacts on agricultural production have been severe in the Americas, Europe, and parts of Asia, making it a high-priority research organism for disease management strategies .

What is lipoprotein signal peptidase (lspA) and what role does it play in bacterial systems?

Lipoprotein signal peptidase (lspA) is the second enzyme in the bacterial lipoprotein maturation pathway and is essential for bacterial viability . In bacterial systems, lspA functions by cleaving the signal peptide from prolipoproteins after they have been modified with lipid moieties. This cleavage is a critical step in the production of mature bacterial lipoproteins, which play diverse roles in bacterial physiology, including cell envelope integrity, nutrient acquisition, and virulence. The enzyme has been identified as a promising target for antibacterial development since it is essential and has no mammalian homologs .

How can recombinant X. fastidiosa lspA be expressed and purified for research purposes?

Expression of recombinant X. fastidiosa lspA presents unique challenges as it is a membrane protein. The following protocol represents a methodological approach based on standard practices for membrane protein expression:

  • Gene cloning: The X. fastidiosa lspA gene is amplified from genomic DNA and cloned into an expression vector with a suitable affinity tag (His-tag or GST-tag).

  • Expression system selection: E. coli strains specialized for membrane protein expression (such as C41/C43) are typically used.

  • Optimization of expression conditions: Lowered temperature (16-20°C), reduced inducer concentration, and extended expression time help prevent inclusion body formation.

  • Membrane fraction isolation: After cell lysis, the membrane fraction containing lspA is isolated by ultracentrifugation.

  • Detergent solubilization: The membrane fraction is solubilized using detergents compatible with maintaining lspA enzymatic activity.

  • Affinity purification: The tagged protein is purified using affinity chromatography.

  • Size exclusion chromatography: This step helps remove aggregates and further purify the protein.

Activity assays should be performed at each purification step to ensure the enzyme remains functional.

How does cell-cell signaling affect lspA function in X. fastidiosa?

Cell-cell signaling in X. fastidiosa, particularly through the diffusible signal factor (DSF) regulated by the rpfF gene, controls interactions with both insect vectors and plant hosts . While there is no direct evidence from the search results linking DSF signaling specifically to lspA function, several hypotheses can be formulated:

  • DSF signaling might regulate lspA expression as part of a coordinated response during host interaction or biofilm formation.

  • lspA-processed lipoproteins may be components of the signaling pathways regulated by DSF.

  • DSF-regulated exopolysaccharide production, which affects biofilm formation, may create microenvironments that influence lspA enzymatic activity.

To investigate these possibilities, experimental approaches could include:

  • Transcriptomic/proteomic comparison of lspA expression in wild-type and rpfF mutant strains

  • Identification of lipoproteins whose maturation is coordinated with DSF signaling

  • Evaluation of lspA enzymatic activity under conditions of varying DSF concentration

What is the relationship between type I restriction-modification systems and lspA in X. fastidiosa?

X. fastidiosa possesses several type I restriction-modification (R-M) systems that influence horizontal gene transfer and recombination . These systems themselves may undergo recombination, generating novel alleles with new target specificities. The relationship between R-M systems and lspA could involve:

  • Influence on lspA gene acquisition: R-M systems may affect horizontal transfer of lspA variants between strains.

  • Epigenetic regulation: DNA methylation patterns established by R-M systems might affect lspA expression.

  • Co-evolution: lspA and R-M systems might co-evolve as part of the bacterial defense against foreign DNA.

To study this relationship, researchers could:

  • Compare lspA sequence conservation across strains with different R-M system profiles

  • Analyze methylation patterns in the lspA promoter region

  • Investigate whether R-M system composition affects lipoprotein processing efficiency

How can structure-based approaches be used to design inhibitors of X. fastidiosa lspA?

Structure-based design of lspA inhibitors represents a promising approach for developing novel control strategies against X. fastidiosa. Based on computational design approaches for bacterial peptidases, the following methodology could be employed :

  • Homology modeling: Generate a 3D structural model of X. fastidiosa lspA based on crystal structures of lspA from other bacteria.

  • Binding site identification: Identify catalytic residues and substrate binding pockets through structural analysis and sequence alignment.

  • Virtual screening: Use in silico docking to screen compound libraries for potential inhibitors.

  • Rational design: Create cyclic peptide inhibitors that mimic the natural substrate but resist cleavage.

  • Iterative optimization: Test initial compounds and refine based on structure-activity relationships.

A gel-shift assay can be used to validate inhibitor efficacy, where inhibition of lspA activity is quantified by measuring the signal intensity of the cleaved product .

What assays can be used to measure lspA activity in vitro?

Several complementary approaches can be employed to assess the enzymatic activity of recombinant X. fastidiosa lspA:

  • Gel-shift assay: This approach, as referenced in the search results, involves tracking the molecular weight shift that occurs when lspA cleaves the signal peptide from a prolipoprotein. The assay uses a recombinant substrate (like prepro inhibitor of cysteine protease, ppICP) that is first converted by Lgt using dioleoylphosphatidylglycerol (DOPG) as the lipid substrate, then cleaved by lspA, resulting in a ~10 kDa molecular weight shift detectable by SDS-PAGE .

  • FRET-based assays: Synthetic peptide substrates containing fluorophore-quencher pairs positioned around the lspA cleavage site can enable real-time, quantitative measurement of enzymatic activity.

  • Mass spectrometry: LC-MS/MS analysis of reaction products provides precise identification of cleavage sites and can quantify reaction kinetics.

Each method offers different advantages in terms of sensitivity, throughput, and the type of information provided.

How can genetic manipulation techniques be optimized for studying lspA in X. fastidiosa?

X. fastidiosa strains can be difficult to manipulate genetically using standard transformation techniques . Additionally, since lspA is essential for bacterial viability, complete knockout mutants would likely be lethal. Researchers can employ several strategies to overcome these challenges:

  • Conditional expression systems: Use inducible promoters to control lspA expression levels, allowing for depletion studies.

  • Domain-specific mutations: Create mutations in specific functional domains rather than complete gene deletions.

  • Complementation systems: Express a functional copy of lspA from a plasmid while modifying the chromosomal copy.

  • CRISPR interference (CRISPRi): Use modified CRISPR systems to repress lspA transcription without modifying the gene sequence.

  • Temperature-sensitive alleles: Generate lspA variants that function normally at permissive temperatures but lose activity at restrictive temperatures.

These approaches should be validated using appropriate controls and activity assays to confirm the desired effect on lspA function.

How can the role of lspA-processed lipoproteins in X. fastidiosa biofilm formation be investigated?

X. fastidiosa forms biofilms in both plant hosts and insect vectors, with different architectural properties in each environment . To investigate the role of lspA-processed lipoproteins in biofilm formation:

  • Conditional lspA mutants: Generate strains with regulated lspA expression to observe the effect of lipoprotein processing on biofilm development.

  • Fluorescent tagging: Express fluorescently tagged versions of candidate lipoproteins to visualize their localization within biofilms.

  • Microscopy techniques: Use confocal laser scanning microscopy to analyze biofilm architecture and composition under different conditions.

  • Proteomics: Compare the lipoprotein profile in planktonic cells versus biofilm cells to identify biofilm-specific lipoproteins.

  • In vitro and in planta biofilm assays: Compare biofilm formation on artificial surfaces and in plant vessels when lspA activity is modulated.

  • Vector transmission studies: Assess whether disruption of lspA affects biofilm formation in insect vectors and subsequent transmission efficiency.

Inhibitor Design and Efficacy

Based on computational design approaches for bacterial peptidases, cyclic peptide inhibitors have shown promise against lipoprotein signal peptidase enzymes. The following table summarizes potential inhibitor classes:

Inhibitor ClassRepresentative CompoundsMechanism of ActionValidation Method
Natural productsGlobomycinCompetitive inhibitionSDS-PAGE gel-shift assay
Synthetic cyclic peptidesG2a, G2dMimics signal peptide structureSDS-PAGE gel-shift assay
First-generation compoundsG1bBinds to active siteSDS-PAGE gel-shift assay

These compounds have been confirmed as specific inhibitors of lipoprotein signal peptidase activity through in vitro assays .

Relationship Between X. fastidiosa lspA and Pathogenicity

The role of lspA in X. fastidiosa pathogenicity can be inferred from our understanding of bacterial lipoprotein function:

  • Cell envelope integrity: lspA-processed lipoproteins are critical components of the bacterial cell envelope, which must maintain integrity during plant xylem colonization.

  • Nutrient acquisition: Many bacterial lipoproteins function in nutrient transport and acquisition, essential processes for X. fastidiosa survival in nutrient-poor xylem.

  • Host-pathogen interactions: Surface-exposed lipoproteins may be involved in interactions with host defense mechanisms or in adhesion to xylem vessels.

  • Biofilm formation: X. fastidiosa requires biofilm formation for both host colonization and vector transmission, processes potentially dependent on properly processed lipoproteins .

Predicted Impact of lspA Inhibition on X. fastidiosa Biology

Biological ProcessPredicted Effect of lspA InhibitionPotential Mechanism
Biofilm FormationDisruption of architectureImpaired lipoprotein processing affecting adhesion and matrix components
Cell-Cell SignalingReduced signal transmissionInterference with lipoprotein-dependent signaling pathways
Vector TransmissionDecreased efficiencyDisruption of insect colonization and biofilm formation
VirulencePotentially attenuatedCompromised cell envelope and impaired nutrient acquisition

Structural Characterization of X. fastidiosa lspA

Despite its essential role, the three-dimensional structure of X. fastidiosa lspA remains uncharacterized. Future research priorities should include:

  • Crystallization and X-ray diffraction studies of purified recombinant lspA.

  • Cryo-electron microscopy as an alternative approach for structural determination.

  • Molecular dynamics simulations to understand substrate interactions and inhibitor binding.

  • Site-directed mutagenesis to validate the functional importance of predicted catalytic residues.

Comparative Analysis of lspA Across X. fastidiosa Subspecies

X. fastidiosa exhibits significant strain variation in host range and virulence . Comparative analysis of lspA across subspecies could reveal:

  • Sequence conservation and variation patterns that might correlate with host specificity.

  • Subspecies-specific differences in substrate recognition.

  • Evolutionary patterns suggesting selection pressures on this essential enzyme.

  • Potential subspecies-specific inhibitors for targeted disease management.

Integration of lspA Research with X. fastidiosa Transmission Biology

The unique biology of X. fastidiosa, particularly its dependence on insect vector transmission, suggests future research should integrate lspA studies with transmission biology :

  • Effects of lspA inhibition on insect acquisition and transmission efficiency.

  • Role of lspA-processed lipoproteins in biofilm formation within insect vectors.

  • Potential use of lspA inhibitors as transmission-blocking agents in integrated disease management.

  • Impact of natural environmental factors on lspA activity and subsequent effects on transmission dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.