Recombinant Xylella fastidiosa NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; PD_0258; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Target Names
nuoK
Target Protein Sequence
MISLGHLLALGAVLFCISLAGIFLNRKNVIVLLMSIELMLLAVNVNFIAFSRQLGDTAGQ LFVFFILTVAAAEAAIGLAILVTLFRTHHTINVAEVDALKG
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle in the respiratory chain, transferring electrons from NADH to quinones via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation across the cytoplasmic membrane. For every two electrons transferred, four hydrogen ions are translocated, effectively conserving the redox energy in a proton gradient.
Database Links

KEGG: xft:PD_0258

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is NADH-quinone oxidoreductase subunit K in Xylella fastidiosa and what is its significance in bacterial metabolism?

    NADH-quinone oxidoreductase subunit K (nuoK) is a membrane-associated protein subunit of respiratory complex I in Xylella fastidiosa. This protein functions in the electron transport chain, transferring electrons from NADH to quinones, thereby contributing to cellular energy production. The nuoK protein has been characterized as a small hydrophobic subunit (101 amino acids) with multiple transmembrane domains . In Xylella fastidiosa, the protein is encoded by the nuoK gene (PD_0258 in strain Temecula1 or XF_0315 in other strains) .

    Methodologically, researchers can study nuoK's role in metabolism by:

    • Measuring electron transfer rates using purified recombinant protein

    • Analyzing oxygen consumption and hydrogen peroxide production during enzymatic activity

    • Conducting growth studies with nuoK mutants under various carbon sources

    The significance of nuoK extends beyond energy metabolism, as NADH-quinone oxidoreductases may play roles in oxidative stress response through the scavenging of superoxide radicals, similar to what has been observed in other bacterial systems .

  • What are the structural characteristics of nuoK in Xylella fastidiosa?

    The nuoK protein in Xylella fastidiosa exhibits distinct structural characteristics that facilitate its membrane association and catalytic function:

    FeatureDescription
    Length101 amino acids (full-length protein)
    Structural elementsMultiple transmembrane domains (hydrophobic regions)
    Amino acid sequenceMISLGHLLAIGAVLFCISLAGIF LNRKNVIVLLMSIELLLAVNVNF IAFSRQLGDTAGQLFVFFILTVAA AEAAIGLAILVTLFRTHHTINVAEVDALKG
    MotifsConserved regions typical of NADH dehydrogenase I subunits
    Cofactor associationLikely interfaces with flavin mononucleotide (FMN) molecules in the complex

    Research methods for structural characterization include:

    • Hydropathy analysis for transmembrane domain prediction

    • Structural homology modeling based on related proteins

    • Membrane protein crystallization techniques (though particularly challenging)

    • Cryogenic electron microscopy for complex I structure determination

    Minor sequence variations exist between strains, for example, between Temecula1 (Q87EP5) and other strains (Q9PGI5), which may reflect adaptation to different ecological niches .

Advanced Research Questions

  • How does recombinant nuoK expression differ between symptomatic and asymptomatic plant hosts?

    Research comparing Xylella fastidiosa gene expression in symptomatic versus asymptomatic hosts indicates potential differences in nuoK expression patterns that may correlate with disease progression:

    Studies investigating X. fastidiosa in symptomatic Pera variety citrus versus asymptomatic Navelina ISA 315 cultivar have revealed differential expression of metabolic genes . While not specifically focusing on nuoK, these studies provide a methodological framework for investigating nuoK expression:

    Host StatusObserved PatternsPotential Mechanistic Explanation
    SymptomaticPotentially higher expression of energy metabolism genesGreater bacterial population and nutrient demand
    AsymptomaticPotentially modified expression of virulence factorsBalanced host-pathogen interaction or quorum sensing effects

    Methodological approaches for investigating differential nuoK expression include:

    • RNA extraction directly from infected plant tissues without culturing

    • Quantitative PCR targeting nuoK transcripts

    • RNA-seq analysis comparing expression profiles

    • In situ hybridization to localize nuoK expression within infected tissues

    The expression patterns may also be influenced by the rpfF-mediated cell-cell signaling system, which controls biofilm formation and virulence in X. fastidiosa .

  • How can nuoK be targeted for developing novel control strategies against Xylella fastidiosa?

    The essential metabolic role of nuoK presents potential opportunities for targeted control strategies against Xylella fastidiosa:

    Targeting ApproachMechanismResearch Considerations
    Small molecule inhibitorsDisruption of nuoK function in electron transportRequires high specificity to avoid toxicity to host plants
    Peptide inhibitorsCompetitive binding to disrupt protein-protein interactionsMust address delivery challenges in planta
    Genetic interferenceSilencing or downregulation of nuoK expressionMay utilize RNAi or CRISPR technologies

    Methodological approaches for developing such controls include:

    • High-throughput screening of compound libraries for specific nuoK inhibitors

    • Structure-based drug design targeting nuoK active sites

    • Development of delivery systems for nuoK inhibitors via plant vasculature

    • Evaluation of resistance development potential through experimental evolution studies

    The increasing understanding of Xylella fastidiosa's genetic diversity and recombination capabilities suggests that targeting highly conserved regions of nuoK might provide more durable control strategies than targeting variable regions that could evolve resistance more rapidly.

  • How do mutations in nuoK affect Xylella fastidiosa virulence and host specificity?

    Mutations in nuoK could potentially affect Xylella fastidiosa virulence and host specificity through several mechanisms:

    1. Energy metabolism disruption: Mutations affecting electron transport efficiency could reduce bacterial growth and colonization capacity

    2. Oxidative stress tolerance: Alterations in superoxide scavenging ability could affect survival in different plant environments

    3. Membrane integrity: As a transmembrane protein, nuoK mutations might affect bacterial cell envelope properties

    4. Signaling pathways: Energy metabolism is linked to virulence signaling in many bacteria

    Research approaches to investigate these effects include:

    • Site-directed mutagenesis of conserved residues in nuoK

    • Phenotypic characterization of mutants in various host plants

    • Transcriptomic analysis of host response to wild-type versus mutant strains

    • Competition assays between wild-type and mutant strains in planta

    The genetic plasticity of Xylella fastidiosa, particularly its ability to undergo homologous recombination , suggests that natural variations in nuoK may contribute to adaptation to different host plants and environmental conditions.

Methodological Research Questions

  • What are the optimal conditions for recombinant expression of nuoK from Xylella fastidiosa?

    Expressing membrane proteins like nuoK presents significant challenges, requiring optimized conditions:

    Expression ParameterOptimization Considerations
    Expression systemE. coli strains specialized for membrane proteins (C41, C43) or cell-free systems
    Expression vectorSelection of appropriate fusion tags (His, GST, MBP) to enhance solubility
    Induction conditionsLower temperatures (16-25°C), reduced inducer concentrations
    Media compositionSupplementation with specific phospholipids to support membrane protein folding
    Extraction conditionsGentle detergents (DDM, LDAO) for membrane solubilization

    Based on the available product information , recombinant nuoK protein has been successfully produced, suggesting that expression challenges can be overcome with appropriate methodologies.

    When working with recombinant nuoK, researchers should consider:

    • Tris-based buffers with 50% glycerol appear suitable for storage

    • Storage at -20°C is recommended, with extended storage at -80°C

    • Avoiding repeated freeze-thaw cycles and preparing working aliquots for short-term use at 4°C

  • What assays are available for measuring the oxidoreductase activity of recombinant nuoK?

    Several biochemical assays can be employed to measure the enzymatic activity of recombinant nuoK:

    Assay TypeMeasurement PrincipleAdvantages/Limitations
    Spectrophotometric NADH oxidationMonitors decrease in absorbance at 340 nm as NADH is oxidizedSimple, quantitative; may lack specificity
    Oxygen consumptionClark-type electrode measures O₂ consumption during enzyme reactionProvides real-time kinetics; requires specialized equipment
    Hydrogen peroxide productionFluorescent or colorimetric detection of H₂O₂ productionCan distinguish between different reaction pathways
    Superoxide scavengingInhibition of superoxide-dependent reactions (e.g., cytochrome c reduction)Specifically measures superoxide interactions

    When characterizing nuoK activity, researchers should consider:

    • Control experiments with specific inhibitors to confirm reaction specificity

    • Determination of kinetic parameters (Km, Vmax) for both NADH and quinone substrates

    • Effects of pH, temperature, and ionic conditions on enzyme activity

    • Potential confounding factors like auto-oxidation of reduced enzyme

    For example, studies on related NAD(P)H:quinone oxidoreductases have determined kinetic parameters such as Km values for NADH (14-19 μM) and benzoquinone (5.8-37 μM) , which can serve as reference points for Xylella fastidiosa nuoK characterization.

  • How can gene knockout experiments be designed to study nuoK function in vivo?

    Gene knockout experiments provide powerful tools for understanding nuoK function in Xylella fastidiosa:

    Experimental ApproachMethod DescriptionAdvantages/Challenges
    Allelic exchange mutagenesisReplacement of nuoK with antibiotic resistance markerPrecise targeting; requires selectable markers
    Homologous recombinationNatural competence-based gene replacementLeverages natural recombination machinery ; efficiency varies
    CRISPR-Cas9 gene editingTargeted disruption of nuoKPrecise editing; delivery systems needed
    Conditional knockdownInducible repression of nuoK expressionAllows study of essential genes; more complex design

    The natural competence of Xylella fastidiosa facilitates genetic manipulation, with recombination observed in approximately 1 out of 10⁶ cells when exogenous plasmid DNA is supplied. Key considerations for knockout experiment design include:

    • Selection markers: Kanamycin or chloramphenicol resistance genes have been successfully used

    • Confirmation methods: PCR, Southern blotting, and genome sequencing to verify modifications

    • Control strains: Complementation strains to confirm phenotype specificity

    • Phenotypic assays: Growth curves, biofilm formation, plant colonization, and insect transmission tests

    Examples from related gene knockout studies in Xylella fastidiosa, such as the rpfF mutant investigation , provide methodological templates for nuoK functional studies.

Comparative Research Questions

  • How does nuoK from Xylella fastidiosa compare with homologous proteins in other bacterial pathogens?

    Comparative analysis reveals both conservation and divergence between nuoK in Xylella fastidiosa and homologous proteins in other bacteria:

    OrganismProtein HomologyFunctional Implications
    Escherichia coliModerate sequence similarity to nuoK; part of well-characterized complex IProvides structural and functional reference model
    Xanthomonas campestrisHigh sequence similarity (related Xanthomonadaceae)May indicate conserved function in plant-associated bacteria
    Archaeoglobus fulgidusWrbA protein shows functional similarity as NAD(P)H:quinone oxidoreductase Suggests evolutionary conservation of function across domains

    Methodological approaches for comparative analysis include:

    • Multiple sequence alignment to identify conserved residues and domains

    • Structural homology modeling based on characterized homologs

    • Heterologous complementation experiments to test functional conservation

    • Comparative biochemical characterization of purified homologous proteins

    The WrbA family of NAD(P)H:quinone oxidoreductases, which shares functional similarity with complex I components, has been documented across all three domains of life , suggesting fundamental importance for these oxidoreductases in cellular metabolism and stress response.

  • How has recombination affected the evolution of nuoK across Xylella fastidiosa populations?

    Homologous recombination plays a significant role in Xylella fastidiosa evolution and likely affects nuoK as well:

    Xylella fastidiosa shows evidence of extensive homologous recombination, with rates estimated to be 3.23 times higher than point mutations in contributing to genetic diversity . This recombination can occur:

    • Between different strains within the same subspecies

    • Between different subspecies (intersubspecific recombination)

    • Via natural competence and transformation

    Methodological approaches to investigate recombination effects on nuoK include:

    • Sequence analysis using programs like fastGEAR and BratNextGen to identify recombination events

    • MLST analysis including nuoK and flanking regions

    • Experimental recombination studies using marked strains

    • Population genomics approaches to map recombination hotspots

    Experimental evidence shows that recombination can occur in at least 1 out of 10⁶ cells when exogenous DNA is provided and 1 out of 10⁷ cells during co-culture of different strains . This suggests that nuoK variants could be exchanged between populations, potentially contributing to adaptation to different plant hosts or environmental conditions.

  • What experimental approaches are most effective for studying nuoK function in different environmental conditions?

    Various experimental approaches can be employed to study nuoK function under different environmental conditions:

    Environmental VariableExperimental ApproachMeasurement Parameters
    Temperature variationsGrowth at different temperaturesnuoK expression, enzyme activity, bacterial growth
    pH stressControlled pH mediaProtein stability, electron transport efficiency
    Oxidative stressH₂O₂ or paraquat exposureSuperoxide scavenging activity, survival rates
    Nutrient limitationDefined media with variable nutrient sourcesMetabolic flux through complex I, gene expression
    In planta conditionsInfected plant tissues at different disease stagesIn situ expression, protein localization

    For in planta studies, methodologies have been developed to extract RNA directly from infected plants without culturing bacteria , allowing for analysis of nuoK expression in its natural environment. This approach can be combined with:

    • RT-qPCR for targeted nuoK expression analysis

    • RNA-seq for transcriptome-wide responses

    • Proteomics to assess nuoK protein levels and modifications

    • Metabolomics to link nuoK activity to metabolic outcomes

    These approaches can help determine how environmental factors affect nuoK function, potentially contributing to our understanding of Xylella fastidiosa's adaptation to different plant hosts and its transition between endophytic and pathogenic lifestyles .

Research Development Questions

  • How can structural biology techniques be applied to understand nuoK function in Xylella fastidiosa?

    Advanced structural biology techniques can provide insights into nuoK function and interactions:

    TechniqueApplication to nuoKTechnical Considerations
    X-ray crystallography3D structure determinationChallenging for membrane proteins; may require fusion partners or antibody fragments
    Cryo-electron microscopyVisualization of nuoK within complex IPreserves native structure; requires sophisticated equipment
    NMR spectroscopyDynamics and interactions in solutionLimited by protein size; isotope labeling needed
    Computational modelingPrediction of structure and interactionsRequires validation with experimental data

    Methodological challenges specific to nuoK include:

    • Membrane protein purification while maintaining native structure

    • Reconstitution in appropriate lipid environments

    • Small size (101 amino acids) may complicate some techniques

    • Integration within larger respiratory complex

    Recent advances in membrane protein structural biology, particularly in cryo-EM, have enabled characterization of complex I from several bacteria, providing templates for Xylella fastidiosa nuoK structural studies. Combining structural information with site-directed mutagenesis of conserved residues could establish structure-function relationships crucial for understanding nuoK's role in bacterial metabolism and potential applications in disease management.

  • What role does nuoK play in Xylella fastidiosa biofilm formation and virulence?

    The relationship between energy metabolism, biofilm formation, and virulence in Xylella fastidiosa suggests potential roles for nuoK:

    Biofilm formation is crucial for Xylella fastidiosa's:

    • Colonization of plant xylem vessels

    • Insect vector acquisition and transmission

    • Resistance to host defense responses

    While direct evidence linking nuoK to biofilm formation is limited, several indirect connections exist:

    1. Energy metabolism fuels biofilm development and maintenance

    2. Redox status affects quorum sensing and cell-cell signaling

    3. Oxidative stress response influences biofilm maturation

    4. Membrane proteins like nuoK may affect cell surface properties

    Experimental approaches to investigate these connections include:

    • Comparing biofilm formation between wild-type and nuoK mutants

    • Analyzing expression of nuoK during different stages of biofilm development

    • Evaluating the effects of metabolic inhibitors on biofilm formation

    • Examining interactions between nuoK and known biofilm regulators like the rpf system

    The diffusible signal factor (DSF) system regulated by rpfF has been shown to control biofilm formation and virulence in Xylella fastidiosa , potentially interacting with metabolic pathways involving nuoK.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.