Recombinant Xylella fastidiosa Phosphate transport system permease protein pstC (pstC)

Shipped with Ice Packs
In Stock

Description

Introduction to Xylella fastidiosa

Xylella fastidiosa is a gram-negative bacterium that causes devastating diseases in economically important crops worldwide. The primary control strategy for Xylella fastidiosa diseases involves eradicating infected plants, making timely and accurate detection essential to prevent crop losses and further pathogen dispersal. Conventional diagnostics for this bacterium primarily rely on quantitative PCR (qPCR) assays, though more advanced metagenomic sequencing approaches are being developed to enhance detection sensitivity and account for genetic variations .

The bacterium exists in several subspecies, including Xylella fastidiosa subsp. fastidiosa (Xff) and Xylella fastidiosa subsp. multiplex (Xfm), which can be differentiated through molecular techniques such as Multi-Locus Sequence Typing (MLST) and analysis of specific virulence genes . Research indicates that Xylella fastidiosa's adaptability and pathogenicity are influenced by genetic recombination processes, which can affect various functional proteins including those involved in nutrient acquisition systems .

Among the various proteins that contribute to Xylella fastidiosa's cellular functions, the phosphate transport system plays a critical role in nutrient acquisition, specifically the uptake of inorganic phosphate, which is essential for numerous biological processes including energy metabolism, nucleic acid synthesis, and cell structure maintenance.

Functional Role in Phosphate Transport

The pstC protein serves as a crucial component of the phosphate-specific transport (Pst) system in Xylella fastidiosa. This system belongs to the ATP-binding cassette (ABC) transporter family and is specialized for high-affinity phosphate uptake, which is essential for bacterial survival, particularly in phosphate-limited environments.

In related bacterial systems, the Pst complex typically consists of four main components:

  1. A periplasmic phosphate-binding protein (PstS)

  2. Two transmembrane channel proteins (PstA and PstC)

  3. An ATP-binding protein (PstB) that provides energy for active transport

As one of the transmembrane components, pstC forms part of the channel through which phosphate moves from the periplasmic space into the cytoplasm. The protein's multiple membrane-spanning domains create a selective pathway that ensures specificity for phosphate transport.

Physical and Chemical Properties

The recombinant pstC protein exhibits several characteristic physical and chemical properties that are important for its proper handling and application in research settings:

Table 1: Physical and Chemical Properties of Recombinant pstC Protein

PropertyCharacteristic
Amino Acid Length324 amino acids
Expression Region1-324 (full length)
UniProt AccessionQ87C90
Source StrainXylella fastidiosa (strain Temecula1 / ATCC 700964)
HydrophobicityHigh (multiple transmembrane domains)
Storage BufferTris-based buffer, 50% glycerol
Optimal Storage-20°C or -80°C for extended storage

The high hydrophobicity of this membrane protein necessitates special buffer conditions to maintain its stability and prevent aggregation. Commercial preparations typically include glycerol as a stabilizing agent to protect the protein structure during storage .

Role in Bacterial Fitness and Virulence

Research indicates that phosphate acquisition systems, including components like pstC, are important for bacterial fitness, virulence, and ecological adaptation in plant pathogens like Xylella fastidiosa . Phosphate is an essential nutrient required for various cellular processes, including energy metabolism, nucleic acid synthesis, and cell membrane structure.

The pstC protein, as part of the phosphate transport system, contributes to the bacterium's ability to acquire this critical nutrient from its environment. Efficient phosphate uptake is particularly important in the nutrient-limited environment of plant xylem vessels, where Xylella fastidiosa typically resides. Restrictions in phosphate availability can trigger stress responses in bacteria, potentially affecting their growth, survival, and expression of virulence factors.

Homologous Recombination and Evolution

Research on Xylella fastidiosa has revealed that homologous recombination significantly influences the bacterium's evolution and adaptation. Many genes under recombination are important for bacterial fitness, virulence, and ecological adaptation . While the specific involvement of the pstC gene in recombination events is not explicitly detailed in the provided information, it falls within the category of genes involved in nutrient acquisition, which can be subject to selective pressure during adaptation to new environments.

The study of recombinant forms of proteins like pstC contributes to understanding how genetic variations might affect protein function and, consequently, bacterial adaptability. This knowledge is particularly relevant for a pathogen like Xylella fastidiosa, which infects multiple plant species and must adapt to different host environments.

Applications in Diagnostics and Control Strategies

Recombinant proteins from Xylella fastidiosa can serve as valuable tools in developing diagnostic methods and potential control strategies. As metagenomic sequencing emerges as a promising approach for Xylella fastidiosa identification , characterization of specific proteins like pstC enhances our understanding of the bacterium's genetic makeup and functional capabilities.

Proteins involved in essential cellular functions, such as nutrient acquisition, could potentially serve as targets for developing antimicrobial compounds or other control strategies. Research on recombinant pstC provides resources for studying this protein's structure and function, potentially leading to the identification of vulnerabilities that could be exploited for disease management.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
pstC; PD_1203; Phosphate transport system permease protein PstC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-324
Protein Length
full length protein
Species
Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Target Names
pstC
Target Protein Sequence
MTSTLIPKETSTPGGRDLRDARADYFFKLLLTAAVAFVLIALVSAALSMLWGGRQALQLQ GVSFFYSTEWNPVENKYGALTPIYGTIVTALIAMLIAMPVSLGIAFFLTEVAPRWLRTPI GTAIELLAGIPSIIYGMWGLFVLVPVMTDYITPFLNDHIGTLPLIGTLFQGPPLGIGTLT AGFVLAIMVIPFISSMMREVFLTVPTQLKESAYALGSTKWEVSWNIVLPYTRSAVIGGMF LGLGRALGETMAVAFVIGNSVRLSPSLLTPGTTIAALIANDFGEATETYRSALLLLGFVL FIVTFAVLVIARLMLLRLSRKEGN
Uniprot No.

Target Background

Function
This protein is a component of a binding-protein-dependent phosphate transport system. Its primary function is likely the transmembrane translocation of phosphate substrates.
Database Links

KEGG: xft:PD_1203

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the PstC protein and what role does it play in X. fastidiosa?

PstC functions as a membrane-spanning component of the phosphate-specific transport (Pst) system in X. fastidiosa. As a permease protein, it forms part of the transmembrane channel through which inorganic phosphate is transported into the bacterial cell. The Pst system is typically composed of multiple proteins including PstS (the periplasmic phosphate-binding protein), PstA and PstC (membrane channel proteins), and PstB (the ATP-binding protein) . In X. fastidiosa, this transport system is particularly important given that this pathogen lives in the phosphate-limited environment of the plant xylem, where efficient phosphate acquisition likely contributes to successful colonization and virulence .

How is the pstC gene organized within the X. fastidiosa genome?

The pstC gene in X. fastidiosa is typically located within an operon containing other components of the phosphate transport system. While specific details about pstC organization are not available in the provided search results, comparative genomic studies of X. fastidiosa have revealed that genes involved in nutrient acquisition systems are often highly conserved across strains and subspecies . The gene is likely regulated by PhoBR two-component system, which in bacteria responds to phosphate limitation by activating genes involved in phosphate uptake and metabolism. Based on genomic analyses of X. fastidiosa strains, genes involved in basic cellular processes like nutrient acquisition typically show less genomic rearrangement compared to regions containing virulence factors or mobile genetic elements .

What methods are most effective for recombinant expression of X. fastidiosa PstC?

For recombinant expression of X. fastidiosa PstC, researchers should consider the following optimized protocol based on successful approaches with other X. fastidiosa membrane proteins:

  • Vector selection: Choose expression vectors with promoters that provide moderate expression levels to avoid toxicity issues commonly encountered with membrane proteins.

  • Expression system: E. coli strains like C41(DE3) or C43(DE3), specifically designed for membrane protein expression, are recommended.

  • Growth conditions: Based on protocols for X. fastidiosa proteins, culture at 28°C rather than 37°C may improve protein folding and reduce inclusion body formation .

  • Induction parameters: Use lower concentrations of inducers (e.g., 0.1-0.5 mM IPTG) and extended expression times (16-24 hours).

  • Membrane extraction: Carefully isolate membrane fractions using differential centrifugation followed by solubilization with mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

This approach mitigates common challenges in membrane protein expression including toxicity, misfolding, and aggregation. The natural competence of X. fastidiosa for DNA transformation, as demonstrated in experimental protocols, suggests that homologous recombination techniques could also be useful for genetic manipulation of pstC in its native context .

How conserved is PstC across different X. fastidiosa subspecies?

While the search results don't provide specific information about PstC conservation, we can infer its likely conservation pattern based on what is known about X. fastidiosa genomics. Proteins involved in essential cellular functions like phosphate transport typically show high conservation across bacterial strains and subspecies .

X. fastidiosa is divided into four main subspecies (fastidiosa, multiplex, pauca, and sandyi) that have diverged genetically by 1-3% over approximately 20,000-50,000 years . Comparative genomic analyses have shown that core metabolic functions tend to be highly conserved, while genes involved in host adaptation and virulence show greater variation . As PstC is involved in essential phosphate acquisition, it likely shows high sequence conservation across subspecies, possibly with minor variations that might reflect adaptation to different plant host xylem environments.

The following table represents the predicted conservation pattern based on comparative studies of X. fastidiosa genomes:

Protein FeatureExpected Conservation LevelRationale
Transmembrane domainsVery highCritical for protein function
Phosphate-binding sitesVery highEssential for substrate recognition
Cytoplasmic domainsModerate to highMay have subspecies-specific interactions
Periplasmic loopsModerateMore exposed to selective pressures

What are the standard methods for detecting PstC expression during X. fastidiosa infection?

To detect PstC expression during X. fastidiosa infection, researchers typically employ the following approaches:

  • Quantitative RT-PCR: This method allows precise measurement of pstC gene expression levels during different stages of infection. Samples should be collected from infected plant tissue at different time points (early, middle, and late infection stages).

  • RNA-Seq analysis: Whole-transcriptome analysis provides comprehensive insights into pstC expression in the context of global gene expression patterns during infection. This approach reveals co-expressed genes and potential regulatory networks.

  • Immunodetection methods: Western blotting or immunofluorescence microscopy using antibodies against PstC can detect and localize the protein in bacterial cells extracted from infected plants.

  • Promoter-reporter fusions: Genetic constructs linking the pstC promoter to reporter genes (e.g., GFP, luciferase) can be introduced into X. fastidiosa through natural transformation methods , allowing in vivo monitoring of gene expression.

  • Proteomics approach: Mass spectrometry-based proteomic analysis of X. fastidiosa cells isolated from infected plants can identify and quantify PstC protein levels.

When implementing these methods, researchers should consider the challenges of working with X. fastidiosa, including its slow growth and the difficulty of culturing from some plant hosts . Additionally, the natural competence of X. fastidiosa for transformation (approximately one cell in 10^6 to 10^7) should be considered when designing genetic studies involving recombinant constructs .

How might genetic recombination affect PstC function and diversity across X. fastidiosa strains?

Genetic recombination plays a significant role in X. fastidiosa evolution and adaptation, potentially affecting PstC function and diversity. X. fastidiosa has been demonstrated to be naturally competent, capable of taking up exogenous DNA and incorporating it into its genome through homologous recombination . Experimental data shows recombination occurring in approximately one out of every 10^6 cells when exogenous plasmid DNA is supplied and one out of every 10^7 cells when different strains are grown together in vitro .

Intersubspecific homologous recombination (IHR) between previously geographically isolated X. fastidiosa subspecies has been documented and appears to facilitate host shifts . This recombination can occur at relatively high rates and significantly shapes X. fastidiosa genetic diversity . For a membrane protein like PstC that interfaces directly with the host environment, such recombination events could potentially:

  • Introduce adaptive variations: Recombination might transfer adaptive mutations that optimize phosphate acquisition in different plant xylem environments.

  • Create chimeric proteins: IHR can generate chimeric alleles containing sequences from different subspecies, as demonstrated for multiple X. fastidiosa loci . For PstC, this could potentially create proteins with novel functional properties.

  • Modulate expression regulation: Recombination events affecting promoter regions could alter expression patterns of pstC in response to environmental signals during infection.

  • Impact protein-protein interactions: Variations in PstC resulting from recombination might affect interactions with other components of the phosphate transport system.

The experimental transformation protocol established for X. fastidiosa, involving growth in modified XFM media for approximately 2 days followed by addition of DNA (5 μg/ml) for 24 hours , provides a methodology to study how recombination affects pstC function and diversity.

What is the relationship between phosphate acquisition via PstC and X. fastidiosa virulence?

Phosphate acquisition via the PstC-containing transport system likely plays a crucial role in X. fastidiosa virulence, though this relationship is complex and context-dependent. X. fastidiosa causes disease symptoms primarily through xylem vessel colonization and obstruction, developing biofilm-like structures that are crucial for both insect transmission and plant colonization . The connection between phosphate transport and virulence may involve several mechanisms:

  • Biofilm formation: Phosphate limitation is a known trigger for biofilm formation in many bacteria. The PstC transport system may influence biofilm development in X. fastidiosa, which is crucial for virulence . Biofilms protect bacterial cells and contribute to xylem occlusions that cause disease symptoms.

  • Signal transduction: In many bacteria, the Pst system is integrated with the PhoBR two-component regulatory system that controls numerous virulence-associated genes. Mutations in pstC could potentially affect this signaling pathway.

  • Adaptation to xylem environment: Plant xylem is generally phosphate-limited, making efficient phosphate acquisition via PstC essential for X. fastidiosa proliferation during infection.

  • Host-specific adaptation: Different plant hosts may present varying phosphate availability in their xylem, potentially selecting for PstC variants optimized for specific hosts. This may contribute to the host specificity observed among X. fastidiosa subspecies and strains .

  • Cell wall modifications: Phosphate limitation can trigger changes in bacterial cell wall composition, potentially affecting interactions with plant defense responses.

Experimental approaches to investigate this relationship could include creating pstC mutants using natural transformation and assessing their virulence in different host plants, as well as examining pstC expression patterns during disease progression.

How can structural biology approaches enhance our understanding of PstC function?

Structural biology approaches can significantly advance our understanding of X. fastidiosa PstC function through the following methodologies:

  • X-ray crystallography: Determination of PstC crystal structure would reveal detailed molecular architecture, including transmembrane domains and substrate binding sites. This requires:

    • High-yield expression of recombinant PstC

    • Protein purification maintaining native conformation

    • Crystallization screening with and without phosphate

    • Data collection at synchrotron facilities

  • Cryo-electron microscopy (cryo-EM): This approach can visualize the entire Pst complex, revealing how PstC interacts with other components (PstA, PstB, PstS). Single-particle cryo-EM is particularly valuable for membrane protein complexes that resist crystallization.

  • NMR spectroscopy: For specific domains or segments of PstC, solution NMR can provide insights into dynamic aspects of the protein, including conformational changes during phosphate transport.

  • Molecular dynamics simulations: Using structural data, computational modeling can simulate:

    • Phosphate passage through the transmembrane channel

    • Conformational changes during transport

    • Effects of mutations on protein dynamics

    • Interactions with lipid bilayers

  • Structure-guided mutagenesis: Based on structural insights, targeted mutations can be introduced into X. fastidiosa using natural transformation methods to validate the functional significance of specific residues.

These approaches would help identify potential targets for inhibiting phosphate transport as a strategy to control X. fastidiosa infections. The established transformation efficiency (one successful recombination event per 10^6 cells) provides a framework for introducing and testing structure-guided mutations in X. fastidiosa.

What role might PstC play in X. fastidiosa adaptation to different plant hosts?

X. fastidiosa has an extremely wide host range, with 563 plant species reported as hosts across 82 botanical families . The PstC protein may play a significant role in adaptation to this diverse range of plant hosts through several mechanisms:

  • Xylem composition adaptation: Different plant species have varying xylem phosphate concentrations and compositions. PstC variants might optimize phosphate acquisition in specific host xylem environments, potentially contributing to the host specificity observed among X. fastidiosa subspecies .

  • Interaction with host-specific factors: PstC, as a membrane protein, may interact with host-specific xylem components that affect its function. Variations in PstC could potentially modify these interactions in ways that enhance bacterial survival in specific hosts.

  • Contribution to host immunity evasion: Differences in plant immune responses may select for variations in bacterial surface proteins, potentially including PstC, that minimize recognition by host defense systems.

  • Association with recombination events: Intersubspecific recombination in X. fastidiosa has been associated with adaptation to novel hosts . If pstC is involved in such recombination events, it could contribute to host range expansion.

  • Co-evolution with carbohydrate utilization systems: Compatibility between xylem pit membrane carbohydrate composition and X. fastidiosa CWDEs has been suggested as a determinant of host specificity . Phosphate acquisition systems may co-evolve with these carbohydrate utilization systems.

Research approaches to investigate this role include comparative genomic analysis of pstC sequences from X. fastidiosa strains isolated from different hosts, experimental testing of engineered pstC variants in multiple host plants, and transcriptomic analysis of pstC expression patterns during infection of different host species.

What experimental approaches can be used to study the function of PstC in phosphate-limited conditions?

Studying PstC function under phosphate-limited conditions, which mimic the xylem environment, requires specialized experimental approaches:

  • Defined media studies: Using modified XFM media with controlled phosphate concentrations to assess:

    • Growth rates of wild-type vs. pstC mutants

    • Phosphate uptake kinetics

    • Gene expression changes

    Based on established protocols, cultures should be prepared at initial OD600 of 0.005-0.05 (approximately 10^6 to 2×10^7 CFU/ml) and monitored over 7-9 days .

  • Radioactive phosphate uptake assays: Using 32P or 33P-labeled phosphate to directly measure transport activity in:

    • Wild-type X. fastidiosa

    • pstC mutants

    • Strains with modified pstC variants

  • Fluorescent phosphate analogs: Using fluorescently labeled phosphate analogs to visualize and quantify uptake at the single-cell level.

  • In planta studies: Examining pstC expression and bacterial growth in:

    • Phosphate-fertilized plants

    • Phosphate-limited plants

    • Different plant species with varying xylem phosphate content

  • Transcriptomics under phosphate limitation: RNA-Seq analysis comparing global gene expression patterns between:

ConditionpstC ExpressionAssociated GenesPhysiological Response
High phosphateLowBasic metabolismRapid growth, low biofilm
Limited phosphateHighStress response genesSlow growth, increased biofilm
pstC mutantN/ACompensatory transportersAltered virulence phenotype
  • Biofilm formation assessment: Quantifying biofilm formation under varying phosphate concentrations, as biofilm-like structures are crucial for X. fastidiosa colonization and pathogenesis .

  • Competitive growth assays: Co-culturing wild-type and pstC mutant strains (similar to the protocol used in recombination studies ) to assess fitness effects under phosphate limitation.

These approaches would provide comprehensive insights into how PstC functions in the phosphate-limited conditions that X. fastidiosa encounters during plant infection, potentially revealing new targets for disease management strategies.

What are the best methods for generating and confirming X. fastidiosa pstC mutants?

Based on established protocols for X. fastidiosa genetic manipulation, the following methodological approach is recommended for generating and confirming pstC mutants:

  • Mutant construction:

    • Design a plasmid containing a pstC gene disrupted by an antibiotic resistance cassette (e.g., kanamycin resistance)

    • Include approximately 1 kb of flanking sequence on each side of the disrupted gene to facilitate homologous recombination

    • PCR-amplify the construct to generate linear DNA

  • Natural transformation protocol :

    • Harvest X. fastidiosa cells after approximately 7 days of growth on solid PWG medium

    • Dilute to OD600 of 0.0025-0.05 (approximately 10^6 to 2×10^7 CFU/ml) in 200 μl modified XFM

    • Grow for 2 days at 28°C with constant shaking at 180 rpm

    • Add DNA to a final concentration of 5 μg/ml

    • Continue incubation for 24 hours

    • Plate on selective media containing appropriate antibiotics

    • Expect transformation efficiency of approximately one recombinant per 10^6 cells

  • Mutant confirmation strategies:

    • PCR verification using primers flanking the insertion site

    • Sequencing of the modified locus

    • RT-PCR to confirm absence of pstC transcription

    • Western blot to verify absence of PstC protein

    • Complementation assays to confirm phenotype is due to pstC disruption

  • Phenotypic characterization:

    • Growth curve analysis in phosphate-limited and phosphate-replete media

    • Phosphate uptake assays

    • Biofilm formation assessment

    • Virulence testing in appropriate plant hosts

This approach leverages X. fastidiosa's natural competence, which has been experimentally validated to work efficiently for gene modification . The confirmation steps are essential as transformation frequencies can vary based on growth conditions and DNA methylation status.

How can researchers overcome challenges in expressing and purifying recombinant PstC protein?

Expressing and purifying membrane proteins like PstC presents significant challenges. The following comprehensive approach addresses these challenges:

  • Expression system optimization:

    • Specialized E. coli strains: Use C41(DE3), C43(DE3), or Lemo21(DE3) specifically designed for membrane protein expression

    • Fusion tags: Incorporate MBP, SUMO or Mistic fusion tags that enhance membrane protein solubility

    • Codon optimization: Adjust codon usage for efficient expression in the chosen host

    • Controlled expression: Use tightly regulated promoters with low basal expression

    • Expression conditions: Based on X. fastidiosa protocols, grow at 28°C rather than 37°C to improve folding

  • Solubilization and extraction strategies:

    • Detergent screening: Systematically test multiple detergents (DDM, LMNG, UDM, LDAO)

    • Lipid addition: Include E. coli polar lipids during solubilization

    • Nanodiscs or SMALPs: Consider incorporating the protein into nanodiscs or SMALPs for more native-like environment

    • Thermal stability assays: Use differential scanning fluorimetry to identify optimal solubilization conditions

  • Purification protocol:

    • Affinity chromatography: Use nickel or cobalt affinity as first purification step

    • Size exclusion chromatography: Remove aggregates and ensure monodispersity

    • Ion exchange: Further purify based on surface charge distribution

    • Detergent exchange: Optimize detergent for downstream applications during purification

  • Quality assessment:

    • Size exclusion chromatography: Check for monodispersity

    • SDS-PAGE and Western blot: Verify protein identity and purity

    • Mass spectrometry: Confirm protein sequence

    • Circular dichroism: Verify secondary structure integrity

    • Functional assays: Assess phosphate binding using isothermal titration calorimetry

  • Alternative approaches:

    • Cell-free expression: Consider membrane protein-optimized cell-free systems

    • Truncation constructs: Express specific domains rather than the full protein

    • Chimeric constructs: Replace problematic regions with homologous sequences from related proteins

These strategies are adaptable to specific research goals, whether structural studies requiring high purity or functional assays needing active protein in a near-native state.

What are the most effective approaches for studying PstC-protein interactions within the Pst complex?

Investigating protein interactions involving PstC within the complete phosphate transport system requires specialized techniques suitable for membrane protein complexes:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against PstC or use epitope-tagged versions

    • Solubilize membranes under mild conditions to preserve protein interactions

    • Identify interacting partners by mass spectrometry

    • Verify interactions with reciprocal Co-IP experiments

  • Bacterial two-hybrid systems:

    • BACTH system: Particularly suitable for membrane proteins

    • Fuse PstC domains to T18 and potential partners to T25 fragment of adenylate cyclase

    • Screen for interactions based on cAMP production

    • Quantify interaction strength using β-galactosidase assays

  • Cross-linking coupled with mass spectrometry:

    • Use membrane-permeable crosslinkers like DSS or formaldehyde

    • Apply to intact X. fastidiosa cells or membrane preparations

    • Identify crosslinked peptides by tandem mass spectrometry

    • Map interaction interfaces at amino acid resolution

  • FRET-based approaches:

    • Generate fluorescent protein fusions with PstC and other Pst components

    • Express in X. fastidiosa using established transformation protocols

    • Measure FRET efficiency to assess protein proximity

    • Use acceptor photobleaching or fluorescence lifetime measurements

  • Genetic approaches:

    • Suppressor mutation analysis: Identify compensatory mutations that restore function in pstC mutants

    • Synthetic lethality screens: Identify genes that become essential when pstC is modified

    • Take advantage of X. fastidiosa's natural competence (10^-6 to 10^-7 cells) for genetic manipulation

  • Structural approaches:

    • Cryo-electron microscopy: Visualize the entire Pst complex

    • Protein-protein docking: Computational prediction of interaction interfaces

    • Hydrogen-deuterium exchange: Map protein interaction surfaces

These methodologies provide complementary information about the organization and dynamics of the Pst complex, with each approach having specific strengths for investigating different aspects of PstC interactions.

How can researchers effectively compare PstC function across different X. fastidiosa subspecies?

To effectively compare PstC function across different X. fastidiosa subspecies, researchers should implement a multi-faceted approach that addresses both genetic and functional aspects:

  • Sequence and structural comparison:

    • Perform multiple sequence alignment of pstC genes from different subspecies

    • Identify conserved domains and variable regions

    • Model protein structures to predict functional differences

    • Analyze selection pressure on different protein domains using dN/dS ratios

  • Heterologous expression system:

    • Express PstC variants from different subspecies in a common genetic background

    • Use E. coli phosphate transport mutants as complementation systems

    • Quantify phosphate uptake rates under standardized conditions

    • Assess protein localization and stability

  • Gene replacement experiments:

    • Replace native pstC in one subspecies with variants from other subspecies

    • Utilize natural transformation protocol with efficiency of ~10^-6

    • Evaluate effects on growth, phosphate uptake, and virulence

    • Test function in phosphate-limited conditions mimicking xylem

  • Transcriptional regulation analysis:

    • Compare pstC promoter regions across subspecies

    • Perform reporter gene assays to quantify expression under varying phosphate concentrations

    • Identify subspecies-specific regulatory elements

    • Assess impact of intersubspecific recombination on regulation

  • In planta functional assays:

    • Inoculate multiple host plants with strains carrying different pstC variants

    • Monitor bacterial populations over time in planta

    • Measure phosphate uptake in xylem sap

    • Correlate PstC variation with host range and virulence

This methodology would be particularly valuable for understanding how PstC function might contribute to the host specificity observed among X. fastidiosa subspecies , especially in the context of the documented intersubspecific recombination that has been associated with X. fastidiosa adaptation to novel hosts .

What bioinformatic approaches can be used to analyze PstC evolution and diversity?

Comprehensive bioinformatic analysis of PstC evolution and diversity requires multiple computational approaches:

  • Phylogenetic analysis:

    • Construct maximum likelihood trees of pstC sequences from diverse X. fastidiosa strains

    • Compare pstC phylogeny with whole-genome phylogeny to identify horizontal gene transfer events

    • Implement Bayesian methods to estimate divergence times

    • Correlate evolutionary patterns with host specificity and geographical distribution

  • Detection of recombination events:

    • Apply multiple detection methods including RDP4 program suite and PHI program

    • Implement the introgression test to detect intersubspecific recombination

    • Identify potential chimeric pstC alleles resulting from recombination

    • Map recombination breakpoints within the gene

  • Selection pressure analysis:

    • Calculate site-specific dN/dS ratios to identify regions under positive or purifying selection

    • Implement PAML, FUBAR, or MEME algorithms for selection detection

    • Compare selection patterns between subspecies and across host-specific strains

    • Identify episodic selection possibly related to host shifts

  • Structural implications of sequence variation:

    • Map sequence variations onto predicted 3D protein structures

    • Identify variations in functionally important regions (substrate binding, protein-protein interaction)

    • Predict impacts of amino acid substitutions on protein stability and function

    • Correlate structural predictions with experimental phenotypes

  • Comparative genomic context analysis:

    • Examine the genomic neighborhood of pstC across strains

    • Identify operon structure conservation or variation

    • Compare with other phosphate transport genes (pstA, pstB, pstS)

    • Correlate with mobile genetic elements that might facilitate transfer

This bioinformatic framework would be particularly valuable for understanding how intersubspecific recombination, which has been documented in X. fastidiosa , might have shaped PstC evolution and potentially contributed to host adaptation. The analytical approaches should consider the known divergence between X. fastidiosa subspecies (1-3% genetic divergence over approximately 20,000-50,000 years) as a contextual framework.

How might understanding PstC function contribute to novel control strategies for X. fastidiosa diseases?

Understanding PstC function could lead to several promising control strategies for X. fastidiosa diseases:

  • Small molecule inhibitors:

    • Design competitive inhibitors of phosphate binding to PstC

    • Develop allosteric inhibitors that prevent conformational changes needed for transport

    • Screen chemical libraries against recombinant PstC

    • Test candidates in planta for disease suppression

  • Peptide-based inhibitors:

    • Design peptides that mimic interaction interfaces between PstC and other Pst components

    • Develop delivery methods for peptides into plant xylem

    • Optimize stability for long-term protection

    • Test for specificity to avoid disrupting plant phosphate transporters

  • Host resistance engineering:

    • Identify plant proteins that interact with PstC during infection

    • Engineer modified plant variants that disrupt these interactions

    • Potentially transfer resistance mechanisms between plant species

    • Particularly valuable given X. fastidiosa's extremely wide host range (563 plant species)

  • Phosphate management strategies:

    • Modify xylem phosphate levels to disrupt bacterial phosphate sensing

    • Develop fertilization regimes that reduce bacterial fitness

    • Engineer plants with altered xylem phosphate concentration or availability

    • Test efficacy across different plant hosts

  • Biocontrol approaches:

    • Develop non-pathogenic X. fastidiosa strains with modified pstC as competitive exclusion agents

    • Engineer bacteriophages targeting regions of X. fastidiosa involved in phosphate transport

    • Utilize natural transformation capability (10^-6 efficiency) to introduce modified genes

  • Diagnostic applications:

    • Develop subspecies-specific detection methods based on pstC sequence variations

    • Create rapid tests for identifying subspecies and potential host range

    • Particularly valuable for managing the spread of X. fastidiosa, which has recently expanded from the Americas to Europe

These approaches leverage fundamental knowledge about PstC function to address the significant economic impacts of X. fastidiosa diseases such as Pierce's disease in grape, citrus variegated chlorosis, and the recent emergence in olives in southern Italy .

What are the most promising directions for future research on X. fastidiosa PstC?

Future research on X. fastidiosa PstC should focus on several promising directions:

  • Structural characterization:

    • Determine high-resolution crystal or cryo-EM structures of PstC alone and within the complete Pst complex

    • Map conformational changes during phosphate transport

    • Identify potential binding sites for inhibitor design

    • Compare structures from different subspecies to understand host adaptation

  • Systems biology approach:

    • Integrate transcriptomic, proteomic, and metabolomic data to place PstC in the context of phosphate homeostasis networks

    • Model how phosphate availability affects global gene expression patterns

    • Identify regulatory networks connecting phosphate transport to virulence and biofilm formation

    • Use natural competence to create reporter strains for system-wide studies

  • Host-pathogen interface:

    • Elucidate how PstC function varies in different plant host environments

    • Identify host factors that interact with or influence the Pst system

    • Understand how phosphate acquisition relates to xylem colonization patterns

    • Investigate differences across the wide range of X. fastidiosa host plants (563 species)

  • Recombination and evolution studies:

    • Investigate whether pstC is involved in intersubspecific recombination events

    • Determine how recombination affects PstC function and host adaptation

    • Create synthetic recombinants to test functional hypotheses

    • Trace the evolutionary history of pstC in the context of X. fastidiosa subspecies divergence (1-3% over 20,000-50,000 years)

  • Translational research:

    • Develop high-throughput screening systems for PstC inhibitors

    • Test phosphate transport inhibition as a disease control strategy

    • Explore combination approaches targeting multiple transport systems

    • Evaluate potential for resistance development

  • Novel methodology development:

    • Create improved genetic tools for X. fastidiosa manipulation building on natural competence

    • Develop in planta imaging techniques to visualize phosphate uptake during infection

    • Establish single-cell approaches to study population heterogeneity

    • Design microfluidic systems to mimic xylem environment

These research directions would significantly advance our understanding of X. fastidiosa biology while potentially yielding practical applications for disease management.

How does phosphate transport via PstC interact with other virulence mechanisms in X. fastidiosa?

Phosphate transport via PstC likely interacts with multiple virulence mechanisms in X. fastidiosa through complex regulatory networks:

  • Biofilm formation:

    • X. fastidiosa forms biofilm-like structures crucial for host colonization and pathogenesis

    • Phosphate limitation often triggers biofilm formation in bacteria

    • PstC likely influences biofilm development through PhoBR-mediated signaling

    • Biofilms protect bacterial cells and contribute to xylem occlusions causing disease symptoms

  • Cell wall-degrading enzymes (CWDEs):

    • X. fastidiosa produces CWDEs to degrade pit membranes for systemic movement

    • Phosphate limitation may alter expression and secretion of these enzymes

    • The Type II secretion system (T2SS) responsible for CWDE secretion may be co-regulated with phosphate transport systems

    • This connection potentially links PstC function to bacterial movement through xylem vessels

  • Quorum sensing and cell-cell signaling:

    • X. fastidiosa uses DSF-mediated cell-cell signaling to regulate virulence behaviors

    • Phosphate limitation may affect DSF production or response

    • PstC-mediated phosphate uptake could influence the RpfF/RpfC regulatory system

    • Experimental approaches using natural transformation could test these relationships

  • Twitching motility:

    • X. fastidiosa uses twitching motility for movement and colonization

    • Phosphate homeostasis may affect expression of motility genes

    • PstC function might influence energy availability for motility

    • This connection potentially links phosphate acquisition to bacterial dispersal within hosts

  • Stress responses:

    • Phosphate limitation constitutes a stress condition that triggers multiple adaptive responses

    • The PstSCAB-PhoBR system typically coordinates these responses

    • Cross-talk between phosphate stress response and other stress pathways may occur

    • Understanding these interactions could explain host-specific virulence patterns

The interconnected nature of these systems suggests that PstC function extends beyond simple nutrient acquisition to influence multiple aspects of X. fastidiosa virulence. This perspective is consistent with the observation that X. fastidiosa pathogenicity mechanisms are context-dependent and may vary across different pathosystems .

How can CRISPR-Cas technology be applied to study PstC function in X. fastidiosa?

CRISPR-Cas technology offers powerful approaches for studying PstC function in X. fastidiosa, with several strategic applications:

  • Precise gene editing:

    • Create clean deletions of pstC without antibiotic resistance markers

    • Introduce point mutations to assess the importance of specific residues

    • Generate tagged versions of PstC for localization and interaction studies

    • Deliver CRISPR components using the established natural transformation protocol

  • CRISPRi for conditional knockdowns:

    • Deploy catalytically inactive Cas9 (dCas9) to repress pstC expression

    • Use inducible promoters to control timing of repression

    • Create partial loss-of-function phenotypes to assess dosage effects

    • Study essential genes where complete deletion might be lethal

  • CRISPRa for overexpression studies:

    • Utilize dCas9-based activators to increase pstC expression

    • Assess effects of PstC overexpression on phosphate uptake and virulence

    • Test whether increased expression affects host range

    • Examine potential feedback regulation mechanisms

  • Base editing applications:

    • Employ CRISPR base editors to introduce specific mutations without double-strand breaks

    • Create libraries of PstC variants with different amino acid substitutions

    • Test functional consequences of natural variations observed between subspecies

    • Identify critical residues for phosphate transport

  • Multiplex targeting:

    • Simultaneously modify pstC and related genes in the Pst system

    • Create double or triple mutants to assess functional redundancy

    • Target multiple regulators to uncover complex regulatory networks

    • Combine with transcriptomics to map regulatory pathways

  • In planta applications:

    • Develop methods to deliver CRISPR components to X. fastidiosa during plant infection

    • Create conditional mutations that activate during specific infection stages

    • Use tissue-specific promoters to study PstC function in different plant tissues

    • Potentially develop CRISPR-based control strategies

Implementation would require optimization for X. fastidiosa's particular characteristics, including its natural competence (efficiency ~10^-6) and relatively slow growth. The recent advances in X. fastidiosa genomics and transformation protocols provide a foundation for developing these CRISPR-based approaches.

What role might environmental phosphate availability play in X. fastidiosa host range and geographic distribution?

Environmental phosphate availability may significantly influence X. fastidiosa host range and geographic distribution through several mechanisms:

  • Differential phosphate levels in host plants:

    • Xylem phosphate concentrations vary substantially between plant species

    • PstC efficiency may determine bacterial fitness in phosphate-limited hosts

    • Subspecies-specific adaptations in PstC could contribute to host specificity patterns

    • The extremely wide host range of X. fastidiosa (563 plant species) suggests adaptability to diverse phosphate environments

  • Soil-plant-pathogen interactions:

    • Soil phosphate availability affects plant xylem composition

    • Regional soil differences could create selection pressures on bacterial phosphate acquisition systems

    • Agricultural practices like fertilization might influence bacterial adaptation

    • This could partially explain the geographic clustering of certain X. fastidiosa strains

  • Environmental stress interactions:

    • Phosphate limitation may interact with other environmental stressors (temperature, drought)

    • Climate variations might affect plant phosphate uptake and xylem composition

    • PstC function may be temperature-dependent, influencing geographic range

    • This might contribute to the recent spread of X. fastidiosa to new regions like Europe

  • Seasonal dynamics:

    • Seasonal changes in plant phosphate transport could affect bacterial colonization

    • PstC expression might vary seasonally in response to host phosphate availability

    • Seasonal patterns could influence vector acquisition and transmission efficiency

    • This may explain temporal patterns in disease progression

  • Co-evolution with local plant communities:

    • Local adaptation of PstC to predominant plant hosts in a region

    • Recombination events (as observed in X. fastidiosa ) may transfer adaptive PstC variants

    • Introduced plants might face increased susceptibility to locally adapted strains

    • This perspective could inform risk assessment for X. fastidiosa spread to new regions

Understanding these relationships would be valuable for predicting X. fastidiosa spread, especially given recent expansions from its historical range in the Americas to Europe and the significant economic impact of diseases like Pierce's disease, citrus variegated chlorosis, and olive quick decline syndrome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.