Recombinant Xylella fastidiosa Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; XfasM23_1098; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Xylella fastidiosa (strain M23)
Target Names
ubiB
Target Protein Sequence
MKALFRACRIGKVMLRYRLDTLLDGTAVERWLRLAKPFVPRISAEIVEQSRGRRLRLALQ ELGPIFVKFGQILSTRRDLVPQDIGDELVMLQDRVEPFEGQTARSIIETALGKSVESAFA HFDTVPLASASISQVHAATLHDRRAVVVKVLRPDIEHQISDDIALLKSLATLVEHTHPNA DKIRPREIVAEIETTLAAELDLQREGANASVLRRFWEASDDIYVPEVIWSHTAERVLTLE RMYGIPSDDIALLDASGIDRKALSSKGIRVFYTQVFRDNFFHADAHSGNIWVDSDPARKS NPRFIVLDFGIMGQLSQKDQYYLAENFMAIFHKDYRRIAELHVEAGWIPPHVRIEELEAA ARSVCEPYFTRPLSQISLAEVMMKLFHVARRYQLTLQPQLILLQKTLLNIEGVGRQLDPE LDIWVVARPVLERILRARYSPRHALKELNKRLPEIMTHAPDTPRLIHTWLVQQVESRKQN DVYLQQIRALAMTLQGLQRRVVNAIVGSGLLVAAAVLYGLHPDGLYLGTIPVWSLISGCI GALALFSAWWRS
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ubiquinone biosynthesis proteins in bacterial metabolism?

Ubiquinone (UQ), also known as coenzyme Q, functions primarily as an electron carrier in both prokaryotes and eukaryotes. In bacteria like Escherichia coli, at least eleven proteins are known to participate in UQ biosynthesis, with additional non-enzymatic factors also required for complete functionality . Ubiquinone biosynthesis proteins facilitate electron transfer in the bacterial respiratory chain, making them essential components for energy production and bacterial survival.

The biosynthetic pathway involves multiple steps, with specific proteins catalyzing different reactions in the pathway. For experimental investigation of these proteins, researchers typically employ genetic knockout studies to assess phenotypic effects, complementation analyses to confirm protein function, and biochemical assays to measure ubiquinone production levels.

How are homologous recombination events detected in Xylella fastidiosa strains?

Homologous recombination in X. fastidiosa is detected using multiple complementary approaches:

  • Multilocus Sequence Typing (MLST) analysis to identify sequence types (STs) and unusual allelic combinations

  • Whole Genome Sequencing (WGS) followed by reference mapping of reads and alignment of contigs to parental strain genomes

  • Statistical approaches including:

    • BratNextGen and fastGEAR analysis to detect recombination events

    • Targeted introgression tests to identify specific breakpoints

    • Ratio tests comparing differences between potential donor and recipient sequences

    • Bayesian Analysis of Population Structure (hierBAPS) to classify strains into genetic clusters

These methods allow researchers to identify regions of intersubspecific homologous recombination (IHR) and quantify the genetic exchange between subspecies. For instance, studies have shown significant evidence of introgression from X. fastidiosa subsp. fastidiosa into X. fastidiosa subsp. multiplex in multiple loci .

What experimental approaches can generate recombinant X. fastidiosa strains in laboratory settings?

Laboratory generation of recombinant X. fastidiosa strains utilizes several techniques:

  • Natural transformation with heat-killed cells: Live bacteria are mixed with DNA from dead strains carrying antibiotic-resistance markers or fluorescent proteins (e.g., GFP)

  • Co-culturing of live strains with different markers: Two live strains with different selection markers are grown together, allowing natural competence to facilitate recombination

  • Selection of recombinants: Utilizing antibiotic resistance markers (e.g., kanamycin, chloramphenicol) and/or fluorescent markers (GFP)

The experimental approach can be demonstrated with specific examples:

  • WM1-1(GFP) recombinants were created by mixing live X. fastidiosa subsp. fastidiosa WM1-1 with heat-killed cells of KLN59.3(GFP)

  • Intersubspecific recombinants were generated by mixing X. fastidiosa subsp. multiplex with X. fastidiosa subsp. fastidiosa strains

Subsequent genomic analysis of these laboratory-generated recombinants revealed that recombination events occur not only at the selection marker sites but also at random locations throughout the genome .

How does intersubspecific recombination affect host adaptation in X. fastidiosa?

Intersubspecific homologous recombination (IHR) appears to facilitate host shifts in X. fastidiosa, enabling the bacterium to infect new plant species. Key evidence supporting this hypothesis includes:

  • Recombinant X. fastidiosa subsp. multiplex strains have been found in unique host plants compared to non-recombinant strains

  • Specific host-recombinant associations include:

    • Blueberry: 7 recombinant isolates from Georgia and 3 from Florida

    • Blackberry: 1 recombinant isolate each from Florida and North Carolina

    • These host plants appear to be uniquely associated with recombinant types

The mechanism likely involves the acquisition of genetic material conferring new host adaptation capabilities. For example, recombination may introduce novel genes or allele combinations that allow the bacterium to overcome plant defense mechanisms or utilize host resources more effectively.

Experimentally, researchers can investigate this phenomenon by:

  • Comparing virulence of recombinant vs. non-recombinant strains in different host plants

  • Identifying specific genetic regions acquired through recombination that contribute to host adaptation

  • Conducting cross-inoculation experiments to test host specificity

What bioinformatic tools are most effective for detecting recombination events in bacterial genomes?

Several bioinformatic approaches have proven effective for detecting recombination in X. fastidiosa and other bacterial species:

Tool/MethodFunctionAdvantagesLimitations
ClonalFrameIdentifies mixing of relatively similar allelesEffective for population-level analysisLimited power for within-gene detection
LDhatDetects recombination breaks within genesCommonly used in population geneticsLimited statistical power
PHItestTests for recombination signalsSimple implementationLow sensitivity for subtle recombination
Introgression testIdentifies recombination breakpointsImproved power over other methodsRequires divergent populations
STRUCTURETests loci from multiple taxaIdentifies mosaic allelesRequires prior population definition
BratNextGenDetects recombination eventsEffective for whole genome analysisComputationally intensive
fastGEARAnalyzes recombination patternsWorks well with population genomic dataRequires sufficient genetic diversity
hierBAPSClassifies strains into genetic clustersIdentifies structure without prior assumptionsClustering may not match biological reality

For comprehensive analysis, researchers should employ multiple methods, as each has specific strengths and limitations. Parker et al. noted that using the RDP4 program (which contains 9 recombination detection tests) along with PHI failed to detect intersubspecific recombination in some X. fastidiosa subsp. multiplex isolates that were previously identified as recombinant , highlighting the importance of methodological diversity.

How can researchers distinguish between random genetic variation and true recombination events?

Distinguishing random genetic variation from true recombination events requires a multi-faceted approach:

  • Statistical analysis of sequence patterns:

    • Ratio tests that compare nucleotide differences between potential donor and recipient sequences (e.g., a ratio of 8:0 vs. 0:4 with p=0.004 for holC7 allele)

    • Analysis of recombination breakpoints using targeted introgression tests

    • Identification of mosaic gene segments that abruptly shift from resembling one subspecies to another

  • Genomic context evaluation:

    • Examination of flanking regions around suspected recombination sites

    • Assessment of linkage disequilibrium patterns

    • Analysis of gene content and synteny in recombinant regions

  • Comparison with experimental controls:

    • Laboratory-generated recombinants provide reference patterns

    • Comparison of field isolates with known non-recombinant strains

For X. fastidiosa specifically, researchers have employed these approaches to identify significant evidence of introgression in multiple loci. For example, analysis of the cysG6 allele revealed two regions of intersubspecific recombination with statistical significance (p=0.022) .

What is known about the molecular function of ubiquinone biosynthesis accessory factors?

While specific information about UbiB is not directly provided in the search results, insights can be drawn from related proteins such as UbiK. Accessory factors in ubiquinone biosynthesis appear to:

Methodologically, researchers investigate these functions through:

  • Protein-protein interaction studies (co-immunoprecipitation, bacterial two-hybrid systems)

  • Lipidomic analyses to detect intermediate accumulation

  • Comparative growth experiments under different oxygen conditions

  • Structural biology approaches to determine protein complex architecture

How do genetic modifications to ubiquinone biosynthesis genes affect bacterial virulence?

Alterations in ubiquinone biosynthesis genes can significantly impact bacterial virulence, as demonstrated in various pathosystems:

  • In Salmonella enterica, the UbiK protein was found to be required for:

    • Proliferation in macrophages

    • Virulence in mouse infection models

  • Mechanistic implications:

    • Ubiquinone plays a critical role in electron transport and energy generation

    • Defects in ubiquinone production may impair bacterial metabolism during infection

    • Altered respiration may affect resistance to host defense mechanisms

    • Energy deficits could reduce the production of virulence factors

To experimentally investigate these effects, researchers can:

  • Generate knockout mutants of specific ubiquinone biosynthesis genes

  • Perform complementation studies to confirm gene function

  • Measure virulence in appropriate infection models

  • Quantify bacterial survival in host cells

  • Analyze transcriptomic and proteomic changes in mutant strains during infection

This relationship between ubiquinone biosynthesis and virulence highlights the potential of these pathways as targets for antimicrobial development.

What evolutionary patterns have been observed in homologous recombination in X. fastidiosa?

Evolutionary analysis of homologous recombination in X. fastidiosa has revealed several significant patterns:

  • Subspecies divergence and recombination:

    • X. fastidiosa subspecies (fastidiosa, sandyi, multiplex, and pauca) diverged genetically by 1-3% due to geographical isolation over approximately 20,000-50,000 years

    • Human activity has broken down this isolation, leading to intersubspecific homologous recombination (IHR)

  • Source of recombinant material:

    • Analysis of recombinant X. fastidiosa subsp. multiplex strains showed inconsistencies (12 mismatches) with X. fastidiosa subsp. fastidiosa alleles from the United States

    • These recombinant regions were consistent with alleles from Central America

    • This suggests a single introduction of a Central American strain that subsequently disappeared

  • Extent of recombination:

    • Whole genome sequencing reveals that recombination can affect large portions of the genome

    • Some intersubspecific recombinants show convergence in specific genomic regions, similar to patterns observed in other bacterial species like Salmonella enterica

These patterns suggest that recombination in X. fastidiosa is not random but follows specific evolutionary trajectories, potentially driven by selection for adaptive traits.

How does recombination in X. fastidiosa compare to recombination patterns in other bacterial pathogens?

Comparative analysis reveals both similarities and differences between recombination patterns in X. fastidiosa and other bacterial pathogens:

  • Shared features with other pathogens:

    • Like Salmonella enterica (Typhi and Paratyphi A), X. fastidiosa shows marked convergence across specific portions of the genome, likely reflecting adaptation to specific hosts

    • Similar to Campylobacter jejuni and C. coli, human activity (agriculture) has likely increased recombination between previously isolated bacterial populations

    • As in Helicobacter pylori, X. fastidiosa exhibits random recombination events away from selection markers in experimental settings

  • Unique aspects of X. fastidiosa recombination:

    • The plant pathogen context creates different selection pressures compared to human pathogens

    • Host plant diversity drives distinctive patterns of host-specific adaptation

    • The xylem-limited nature of X. fastidiosa creates specific ecological constraints

  • Methodological implications:

    • Transformation competence has been experimentally confirmed in X. fastidiosa

    • Some isolates carry conjugative plasmids, providing another mechanism for genetic exchange

    • These biological features make X. fastidiosa an excellent model system for studying recombination-driven adaptation

Understanding these comparative patterns helps researchers place X. fastidiosa recombination studies in a broader evolutionary context and apply appropriate methodological approaches derived from other bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.