Recombinant Xylella fastidiosa Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Recombinant Production

The htpX gene (870 bp) is cloned into vectors like pET32Xa/LIC for heterologous expression in E. coli . Key production challenges include:

  • Insoluble Expression: Recombinant HtpX forms inclusion bodies, requiring denaturation/refolding .

  • Thermoregulation: Expression is induced at 37°C but absent at 28°C in minimal media .

ConditionExpression OutcomeCitation
Rich medium (LB)Constitutive transcription at 37°C/45°C
Minimal medium (XDM)Temperature-dependent induction (37°C)
Plant extract supplementationConstitutive expression regardless of temperature

Functional Insights

HtpX contributes to X. fastidiosa pathogenicity through:

  • Biofilm Modulation: AT-1 autotransporter proteases (including HtpX) enable xylem vessel colonization by degrading host tissues .

  • Stress Adaptation: Upregulated during heat shock (37°C) to mitigate protein misfolding .

Mutant Phenotypes:

Mutation TypeObserved EffectSource
htpX deletionReduced biofilm formation and virulence attenuation
Triple protease knockoutNo Pierce’s Disease symptoms despite xylem colonization
Single protease deletionVariable outcomes (hyper-virulent or delayed symptom onset)

Research Applications

Recombinant HtpX serves as:

  • Drug Target: AT-1 proteases are prioritized for anti-microbial strategies due to absence in eukaryotic hosts .

  • Diagnostic Tool: Antibodies against His-tagged HtpX enable pathogen detection (Western blot) .

  • Structural Model: Hydrophobicity profiles inform membrane interaction studies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format preferences, kindly specify your requirements when placing your order. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: All protein shipments are by default accompanied by standard blue ice packs. Should you require dry ice shipping, please communicate your request in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this value as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. Should you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
htpX; XfasM23_2100; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Xylella fastidiosa (strain M23)
Target Names
htpX
Target Protein Sequence
MLTRIVLFAITNIAVLILASIVMSLLGVNPTQMSGLLVMALILGFGGSLISLLMSKAIAK HTTGAYVIEQPRNPSQRWLLDTVRRQAEIVGIGMPEVAIYEGPEINAFATGADRNNALVA VSTGLLQNMSQDEAEAVLGHEIAHVANGDMVTMALLQGVLNTFVIVLARVVGGFIDSLLS GNRGGGRGVAYYGIVLVLELLFGLFATIITMWFSRRREFRADEGGAYLAGRNKMIAALER LGINHGQSTLPTQVQAFGIYGGIGEGLRKLFLSHPPLSERIAALRMARE
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Xylella fastidiosa Protease HtpX and what is its importance in bacterial systems?

Xylella fastidiosa HtpX is a membrane-bound zinc metalloprotease involved in heat shock response. In X. fastidiosa, the htpX gene comprises 870 base pairs and encodes a protein with high sequence identity (53%) to its Escherichia coli homologue . The protein contains a conserved peptidase domain spanning from residue 82 to 289 and a zinc metalloprotease-active site with the sequence HEXXH embedded within domain II . This enzyme plays a crucial role in the proteolytic quality control of membrane proteins, particularly under conditions of stress . As X. fastidiosa was the first phytopathogen to be completely sequenced, studies of its proteins like HtpX provide valuable insights into bacterial stress response mechanisms and potential targets for pathogen control .

How is the htpX gene regulated in Xylella fastidiosa compared to other bacteria?

This pattern differs somewhat from other bacteria. In E. coli, htpX expression is σ32-dependent and regulated by the CpxR/CpxA two-component system, which responds to the accumulation of abnormal membrane proteins . In Bacillus subtilis, htpX expression is strongly heat inducible and under triple negative control by Rok, YkrK, and SigB transcriptional regulators .

When the X. fastidiosa htpX gene with its upstream regulatory region was transferred to E. coli, the thermoregulation pattern was maintained, with constitutive expression at 37°C or 45°C in all media tested, but no expression at 28°C in minimal medium . This conservation of regulation across species highlights the fundamental importance of temperature-sensitive control of this protease.

What are the recommended methods for studying htpX expression in laboratory settings?

Several experimental approaches have been validated for investigating htpX expression and regulation:

  • Transcriptional Analysis:

    • Reverse Transcription PCR (RT-PCR) is the primary method for assessing htpX transcription under different growth conditions .

    • Including 16S rRNA amplification as a control is essential for normalizing cDNA concentrations in RT-PCR experiments .

    • When designing primers, target conserved regions of the htpX coding sequence to ensure specificity.

  • Growth Conditions Optimization:

    • For temperature-dependent expression studies, compare cultures grown at 28°C versus 37°C .

    • Test both rich medium (like PW) and minimal medium (like XDM) to observe differential regulation .

    • Consider supplementing minimal medium with plant extracts to evaluate their effect on htpX expression .

  • Protein Expression Verification:

    • Clone the htpX gene into expression vectors such as pET32Xa/LIC for heterologous expression .

    • Confirm protein expression using Western blot analysis with anti-His tag serum or other epitope tags .

    • Use chemiluminescent detection systems (e.g., CSPD) for optimal sensitivity .

These methods provide a robust framework for investigating htpX expression patterns in response to various environmental conditions, facilitating comparative studies across different bacterial species or mutant strains.

What strategies should be employed to purify functional recombinant HtpX?

Purification of functional HtpX presents significant challenges due to its membrane-bound nature and tendency for self-degradation . The following strategic approach is recommended:

  • Denaturing Purification Protocol:

    • Purify HtpX under denaturing conditions to prevent self-degradation that occurs upon cell disruption or membrane solubilization .

    • Include strong denaturants (6-8M urea or guanidinium hydrochloride) in extraction and purification buffers.

    • Use immobilized metal affinity chromatography (IMAC) with His-tagged constructs for initial purification.

  • Controlled Refolding Strategy:

    • Refold the purified protein gradually through dialysis in the presence of a zinc chelator to prevent premature activation of proteolytic activity .

    • Introduce appropriate detergents (DDM, LDAO, or mild alternatives) during refolding to accommodate the transmembrane domains.

    • Employ a stepwise reduction in denaturant concentration to promote proper folding.

  • Activity Reconstitution:

    • After refolding, supplement with Zn²⁺ in a controlled manner to restore enzymatic function .

    • Verify activity through self-cleavage assays or proteolysis of model substrates like casein .

    • Optimize buffer conditions to maintain stability while preserving catalytic function.

These approaches have been successfully applied to E. coli HtpX and can be adapted for the X. fastidiosa homolog, enabling biochemical and functional characterization of this challenging membrane protease.

How can researchers design an activity assay for recombinant HtpX?

Developing reliable activity assays for HtpX requires careful consideration of its membrane-bound nature and proteolytic mechanism. Several approaches can be implemented:

  • In Vitro Proteolytic Assays:

    • Use casein as a general protease substrate, monitoring degradation in the presence of Zn²⁺ .

    • Develop fluorogenic peptide substrates based on known cleavage sites in natural substrates.

    • Include appropriate controls with zinc chelators (EDTA) to confirm the metal-dependent nature of the activity.

  • Membrane Protein Substrate Assays:

    • Test activity against solubilized membrane proteins such as SecY, which has been confirmed as an HtpX substrate in E. coli .

    • Develop SDS-PAGE or Western blot-based detection methods to visualize substrate cleavage products.

  • In Vivo Model Substrate System:

    • Construct model substrates specifically designed for HtpX, similar to the in vivo semiquantitative protease activity assay system developed for E. coli HtpX .

    • Co-express both HtpX and its potential substrate to verify cleavage in vivo .

    • Use reporter tags (e.g., GFP, msfGFP) to facilitate detection of cleavage events .

  • Self-cleavage Activity Monitoring:

    • Track HtpX self-degradation as an indicator of proteolytic activity .

    • Utilize size-exclusion chromatography or SDS-PAGE to monitor the appearance of cleavage products over time.

These complementary approaches provide multiple ways to assess HtpX activity, enabling researchers to characterize wild-type and mutant variants under different experimental conditions.

What are the key catalytic residues in HtpX and how do they contribute to its proteolytic mechanism?

The catalytic mechanism of HtpX centers around a zinc-binding motif that is characteristic of M48 family metalloproteases:

  • The HEXXH Motif:

    • The conserved HEXXH motif (where X represents any amino acid) is embedded within domain II of X. fastidiosa HtpX .

    • This motif coordinates a zinc ion essential for catalytic activity .

    • The two histidine residues (H) serve as zinc-binding ligands, positioning the metal ion in the active site.

    • The glutamic acid (E) at position 156 in B. subtilis HtpX (corresponding residue in X. fastidiosa) functions as the catalytic residue, likely activating a water molecule for nucleophilic attack on the peptide bond .

  • Additional Functional Residues:

    • Besides the HEXXH motif, a third zinc-coordinating residue (typically another histidine or glutamic acid) is likely present elsewhere in the sequence.

    • Conserved hydrophobic residues surrounding the active site create a substrate-binding pocket that determines specificity.

  • Membrane-Associated Catalysis:

    • The active site is positioned on the cytosolic side of the cytoplasmic membrane , enabling access to cytoplasmic domains of membrane proteins.

    • The transmembrane domains position HtpX properly within the membrane to access its substrates.

This catalytic architecture enables HtpX to perform zinc-dependent proteolysis of both membrane and soluble proteins, contributing to protein quality control particularly under stress conditions.

How does HtpX interact with other components of bacterial stress response systems?

HtpX functions within a complex network of stress response mechanisms, interacting with multiple cellular systems:

  • Coordination with Other Proteases:

    • HtpX works in conjunction with FtsH, a membrane-bound ATP-dependent protease, in the quality control of membrane proteins .

    • In B. subtilis, HtpX and FtsH exhibit partially overlapping functions in heat resistance, as the absence of both causes severe growth defects under heat stress .

    • This functional redundancy suggests they may recognize different features of misfolded proteins or target different substrates.

  • Integration with Stress Response Regulons:

    • In E. coli, htpX expression is σ32-dependent, linking it to the classical heat shock regulon .

    • The gene is also regulated by the CpxR/CpxA two-component system that responds to envelope stress .

    • In B. subtilis, htpX is under triple negative control by rok, sigB, and ykrK transcriptional regulators during heat stress .

  • Nutritional Stress Connections:

    • In X. fastidiosa, htpX expression responds to both temperature and nutrient availability .

    • Constitutive expression in rich medium regardless of temperature suggests integration with nutrient-sensing pathways .

    • Plant extract components can override temperature-dependent regulation , indicating potential host-specific response mechanisms.

This integration into multiple regulatory networks positions HtpX as a multifunctional component of bacterial stress adaptation, particularly in maintaining membrane integrity during adverse conditions.

What are the primary challenges in expressing and characterizing membrane proteases like HtpX?

Researchers working with membrane proteases like HtpX face several significant challenges that must be addressed through specialized approaches:

  • Expression System Limitations:

    • Overexpression of membrane proteases can be toxic to host cells, limiting yield and complicating purification.

    • The hydrophobic nature of transmembrane domains often leads to protein aggregation or misfolding.

    • Proper insertion into host membranes may require specific translocation machinery.

  • Structural Stability Issues:

    • HtpX undergoes self-degradation upon cell disruption or membrane solubilization , complicating purification.

    • The four hydrophobic regions (H1-H4) require detergent stabilization to maintain solubility.

    • Zinc-dependent activity must be carefully controlled to prevent premature self-cleavage.

  • Functional Reconstitution Complexities:

    • Refolding membrane proteins to achieve proper topology is notoriously difficult.

    • Recreating the native membrane environment necessary for physiological activity requires careful detergent or lipid selection.

    • Balancing zinc availability to enable activity while preventing excessive self-degradation requires precise conditions .

  • Substrate Identification Difficulties:

    • Natural substrates of HtpX in X. fastidiosa remain largely unknown.

    • The membrane-localized nature of both enzyme and substrates complicates interaction studies.

    • Developing suitable model substrates that reflect physiological targets is challenging .

These challenges have limited detailed biochemical characterization of HtpX and necessitate innovative approaches combining genetic, biochemical, and biophysical techniques to fully understand its structure-function relationships.

How does the substrate specificity of HtpX compare across different bacterial species?

Understanding the substrate specificity of HtpX across bacterial species remains an active area of research, with several comparative insights emerging:

  • E. coli HtpX Substrates:

    • Confirmed to cleave SecY, a central component of the protein translocation machinery in the cytoplasmic membrane .

    • Also demonstrates proteolytic activity against casein, a soluble model substrate .

    • Likely targets membrane proteins with misfolded cytoplasmic domains exposed to the HtpX active site.

  • X. fastidiosa HtpX Substrates:

    • Natural substrates remain largely unidentified, though structural and sequence similarities with E. coli HtpX suggest potentially conserved targets .

    • The constitutive expression in rich medium suggests it may process a broader range of substrates during rapid growth.

    • Plant extract-induced expression hints at potential roles in processing plant-derived compounds or responding to plant-induced stress.

  • B. subtilis HtpX Substrates:

    • Functional overlap with FtsH suggests shared or complementary substrate profiles .

    • Proposed association with the MreB cytoskeleton suggests potential roles in processing cytoskeletal proteins or associated membrane components.

  • Comparative Substrate Recognition Features:

    • Despite sequence divergence, the conserved HEXXH motif and similar membrane topology suggest a common catalytic mechanism across species .

    • Species-specific regulation patterns may reflect adaptation to different physiological roles and substrate pools.

    • The ability to complement between species (e.g., X. fastidiosa htpX regulation in E. coli) suggests some conservation in substrate recognition mechanisms.

Further research using comparative proteomics and in vivo substrate trapping approaches will be necessary to fully elucidate the species-specific substrate profiles of HtpX proteases.

What are the implications of HtpX function for bacterial pathogenesis and stress adaptation?

The multifaceted roles of HtpX in bacterial physiology have significant implications for pathogenesis and stress adaptation:

  • Heat Stress Survival:

    • Temperature-dependent regulation of htpX in X. fastidiosa and other bacteria suggests critical roles during temperature upshifts encountered during host infection.

    • In B. subtilis, the combined absence of HtpX and FtsH causes severe growth defects under heat stress , indicating their importance for thermotolerance.

    • This heat adaptation function may be particularly relevant for plant pathogens like X. fastidiosa that experience temperature fluctuations in their environmental niches.

  • Membrane Integrity Maintenance:

    • As a membrane-bound zinc metalloprotease, HtpX contributes to the quality control of membrane proteins .

    • This function is crucial for maintaining membrane integrity during host infection and exposure to host defense compounds.

    • Proper membrane function is essential for virulence-associated processes like nutrient acquisition and toxin secretion.

  • Nutritional Adaptation:

    • The differential regulation of htpX in minimal versus rich media in X. fastidiosa suggests roles in adaptation to varying nutrient availability.

    • Constitutive expression in the presence of plant extracts indicates potential involvement in processing plant-derived compounds during infection.

    • This nutritional responsiveness may help pathogens adapt to the changing nutrient landscape during host colonization.

  • Stress Response Integration:

    • The complex regulation of htpX by multiple transcriptional regulators in B. subtilis positions it within sophisticated stress response networks.

    • This integration allows coordinated responses to various environmental stressors encountered during pathogenesis.

    • The triple negative control by rok, sigB, and ykrK at high temperature suggests carefully balanced expression is critical for optimal cellular function.

These implications highlight HtpX as a potential target for antimicrobial strategies that could disrupt bacterial adaptation to host environments, particularly under stress conditions that already challenge pathogen survival.

What innovative approaches could advance our understanding of HtpX structure and function?

Several cutting-edge approaches could significantly advance our understanding of HtpX biology:

  • Cryo-Electron Microscopy for Structural Analysis:

    • Applying single-particle cryo-EM to purified HtpX in nanodiscs or detergent micelles could reveal detailed structural information without requiring crystallization.

    • This approach could resolve the controversy regarding whether all four hydrophobic regions are truly transmembrane segments .

    • Structural comparison with other M48 family metalloproteases could identify unique features of the X. fastidiosa enzyme.

  • In Situ Substrate Identification:

    • Proximity-dependent biotin labeling (BioID or TurboID) fused to catalytically inactive HtpX could identify proteins in the native cellular environment that interact with or are processed by HtpX.

    • Quantitative proteomics comparing wild-type, ΔhtpX, and catalytically inactive htpX strains under various stress conditions could reveal physiological substrates.

    • Developing activity-based probes specific for HtpX could enable dynamic monitoring of its activation in living cells.

  • Advanced Genetic Tools:

    • CRISPR interference (CRISPRi) systems for conditional knockdown of htpX and related genes could reveal subtleties in phenotypes not apparent in complete knockouts.

    • Synthetic genetic array analysis could identify genetic interactions between htpX and other stress response genes, revealing functional networks.

    • Directed evolution approaches could generate HtpX variants with enhanced stability or altered specificity for biochemical characterization.

  • Integrated Systems Biology:

    • Multi-omics approaches integrating transcriptomics, proteomics, and metabolomics data from X. fastidiosa under various stress conditions could position HtpX within larger regulatory networks.

    • Mathematical modeling of membrane protein quality control networks could predict emergent properties and generate testable hypotheses about HtpX function.

    • Comparative genomics across diverse bacterial species could reveal evolutionary patterns in HtpX conservation and specialization.

These innovative approaches would address current knowledge gaps regarding HtpX's structure, substrate specificity, and integration within cellular stress response networks.

How might understanding HtpX function contribute to developing strategies against Xylella fastidiosa infections?

Understanding HtpX function opens several promising avenues for controlling Xylella fastidiosa infections:

  • Targeted Inhibitor Development:

    • The zinc metalloprotease-active site of HtpX with its conserved HEXXH motif presents a druggable target for small molecule inhibitors.

    • Knowledge of HtpX's role in heat stress survival suggests that inhibitors would be particularly effective when combined with treatments that induce temperature stress.

    • Structure-based drug design informed by detailed understanding of the active site could yield specific inhibitors with minimal off-target effects.

  • Stress Sensitization Strategies:

    • The functional overlap between HtpX and FtsH in heat resistance indicates that simultaneously targeting both proteases could create synthetic lethality under stress conditions.

    • Understanding how plant extracts affect htpX expression could reveal natural compounds that modulate its function, potentially identifying plant-derived antimicrobial agents.

    • Creating conditions that induce inappropriate HtpX expression or activity could disrupt bacterial homeostasis.

  • Host-Induced Gene Silencing:

    • Detailed knowledge of htpX regulation enables design of RNA interference approaches targeting this gene in phytopathogens.

    • Transgenic plants expressing dsRNA targeting htpX regulatory regions could reduce pathogen viability during infection.

    • Understanding the specific conditions that upregulate htpX during infection could inform the timing and localization of silencing strategies.

  • Diagnostic Applications:

    • The differential regulation of htpX under various conditions could serve as a basis for molecular diagnostic tools detecting viable X. fastidiosa in plant tissues.

    • Monitoring htpX expression could provide insights into the physiological state of the pathogen during infection and treatment.

    • Development of biosensors responding to HtpX activity could enable rapid field testing for active infections.

These diverse strategies illustrate how fundamental research on bacterial proteases like HtpX can translate into practical applications for managing economically important plant diseases caused by X. fastidiosa.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.