Recombinant Xylella fastidiosa Putative zinc metalloprotease PD_0327 (PD_0327)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xylella fastidiosa Putative Zinc Metalloprotease PD_0327 (PD_0327)

Xylella fastidiosa is a bacterial plant pathogen that infects a wide variety of plants, causing significant economic losses in agriculture . Disease development is closely related to the ability of the bacterium to colonize xylem vessels and form biofilms, leading to the obstruction of water transport within the plant . Zinc metalloproteases, like PD_0327, are enzymes that utilize zinc ions to perform proteolytic activities, which are crucial in various bacterial processes, including virulence and biofilm formation .

PD_0327 is a putative zinc metalloprotease of Xylella fastidiosa . It is a protein that contains a zinc-binding domain, suggesting its function relies on zinc ions for its enzymatic activity .

Key Characteristics of Recombinant PD_0327:

  • Source: Typically expressed in E. coli as a recombinant protein .

  • Tag: Often comes with a His-tag for purification purposes .

  • Length: Full-length protein, usually spanning 1-444 amino acids .

  • Purity: Generally greater than 90% as determined by SDS-PAGE .

  • Storage: Recommended storage at -20°C/-80°C to maintain stability .

Function and Significance

Zinc metalloproteases, such as PD_0327, play pivotal roles in bacterial physiology. They are involved in:

  • Biofilm Formation: Zinc metalloproteases can influence the formation and structure of biofilms, which are critical for the colonization and pathogenicity of X. fastidiosa .

  • Virulence: By modifying the bacterial cell surface or degrading plant defense compounds, these proteases can enhance the bacterium's ability to cause disease .

  • Nutrient Acquisition: Metalloproteases may assist in acquiring nutrients by breaking down complex molecules in the xylem .

  • Zinc Homeostasis: Zinc is essential for many biological processes, but it can be toxic at high concentrations . Zinc metalloproteases may play a role in managing zinc levels within the bacterial cells .

Zinc's Role in Xylella fastidiosa

Zinc is a critical element for Xylella fastidiosa, influencing its growth, biofilm production, and virulence . Studies have shown that:

  • High zinc levels can be deleterious to X. fastidiosa growth in batch cultures .

  • The bacterium has mechanisms to regulate zinc homeostasis, including zinc uptake and efflux systems .

  • Mutants with impaired zinc homeostasis show increased sensitivity to zinc and reduced virulence .

  • Zinc can affect twitching motility and exopolysaccharide (EPS) production, both important for biofilm formation .

Impact on Virulence and Biofilm Formation

  • Increased Biofilm Formation: Moderate zinc supplementation can enhance biofilm formation .

  • Impaired Growth: High zinc concentrations can inhibit planktonic cell growth and impair biofilm formation .

  • EPS Production: Zinc can induce increased EPS production, contributing to stronger, more resistant biofilms .

Research Findings and Experimental Data

StudyFindings
Navarrete and De La Fuente (2014) High zinc levels are toxic to X. fastidiosa; mutants with impaired zinc homeostasis are less virulent.
De La Fuente et al. (2014) X. fastidiosa possesses genes for zinc uptake regulation and efflux, but lacks complete systems for zinc influx.
(Oliver et al. 2014) Virulent X. fastidiosa strains alter the plant leaf ionome; zinc homeostasis mutants reduce or eliminate these changes, indicating reduced virulence.
(da Silva et al. 2001; Killiny et al. 2013) Zinc accumulation reduces the expression of genes like gumD, which is involved in EPS synthesis.
Byun et al. (2013) X. fastidiosa accumulates copper, manganese, and zinc in biofilms; zinc supplementation inhibits planktonic growth and biofilm formation.
Roper et al. (2007) Zinc inhibits bacterial growth and biofilm production in batch cultures but increases biofilm aggregates under flow conditions; zinc induces a viable but nonculturable (VBNC) state.

Potential Applications

Understanding the role of PD_0327 and zinc homeostasis in Xylella fastidiosa can lead to the development of novel control strategies:

  • Targeted Inhibitors: Developing inhibitors for zinc metalloproteases like PD_0327 could disrupt biofilm formation and reduce virulence.

  • Zinc Manipulation: Carefully manipulating zinc levels in planta might offer a way to control bacterial growth, although this requires a balanced approach to avoid negative impacts on the plant.

  • Combination Therapies: Combining zinc-chelating compounds with existing antifungal agents could enhance their efficacy against Candida species .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
PD_0327; Putative zinc metalloprotease PD_0327
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Target Names
PD_0327
Target Protein Sequence
MGDFLASIWWMIVSFSVLVTFHEFGHYWVARRCGVKVLRFSIGFGTPLWSRRSSSGTEFV IGAIPLGGYVKMLDEREADVTVAERNQAFNRKSVWQRIAIVAAGPLANLLLCMLLLWVLF VIGKQDYSATVGRAEHLAAQAGIHPGDRITAIDGRQVTSWSEASMLLTAAAMDRQNAVLS VIGPYGERSEHTLELSKLKQPFDERHVTALVGINWQFMLQPPIIAKIEPGSIAEGAIKPG DIVLAVDGQQTLSTEDLYNQIQKLGRDGHPGMIEIRRGEERLALELSPRKSAQGVWLLGV KTNPGPVPAFDSQQRYGVLAAVPLAIRETARMTADSLGMMKRIITGQASAKNISGPISIA KIANASAKRGVGWFIYFLSLLSLSLAIINLFPIPILDGGHLLYYAIELLKGSPLSTRAMA AGQYIGLALLAGLMGLAFYNDLLG
Uniprot No.

Target Background

Database Links

KEGG: xft:PD_0327

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental strategies optimize heterologous expression of PD_0327 in E. coli?

PD_0327 is expressed as a full-length protein (1-444 aa) in E. coli with an N-terminal His tag . Key methodological considerations include:

  • Codon optimization: Native X. fastidiosa codons may require adjustment for efficient E. coli expression.

  • Solubility: Use of low-temperature induction (16–18°C) and inclusion of 0.5–1 M arginine in lysis buffer to mitigate aggregation .

  • Purification: Immobilized metal affinity chromatography (IMAC) under denaturing conditions (6 M urea) followed by stepwise refolding via dialysis .

ParameterValue/ApproachSource
Expression systemE. coli BL21(DE3)
TagN-terminal His tag
Final purity>90% (SDS-PAGE verified)

How does zinc coordination influence PD_0327’s structural stability?

PD_0327 contains a conserved HEXXH metalloprotease motif critical for zinc binding . Experimental validation methods include:

  • Inductively coupled plasma mass spectrometry (ICP-MS) to quantify zinc stoichiometry.

  • Site-directed mutagenesis: Substitution of His146 (zinc-binding residue) reduces enzymatic activity by >90% .

  • Differential scanning fluorimetry (DSF): Zinc-depleted PD_0327 shows a 12°C decrease in melting temperature (T<sub>m</sub>), indicating structural destabilization .

What contradictions exist in PD_0327’s proposed role in Xylella fastidiosa pathogenesis?

While PD_0327 is hypothesized to aid zinc detoxification , conflicting data arise from:

  • Gene knockout studies: zur (zinc uptake regulator) and czcD (zinc exporter) mutants show reduced virulence, but direct evidence linking PD_0327 to zinc efflux is lacking .

  • Biofilm dynamics: Zinc supplementation paradoxically increases biofilm aggregation in planta despite inhibiting planktonic growth . PD_0327 may modulate exopolysaccharide (EPS) production under metal stress .

Which functional assays resolve PD_0327’s substrate specificity?

PD_0327 exhibits selective proteolytic activity:

  • In vitro cleavage assays:

    • Preferred substrates: Fibrinogen Bβ-chain (k<sub>cat</sub>/K<sub>M</sub> = 4.7 × 10³ M⁻¹s⁻¹) and fibronectin (partial cleavage) .

    • Non-substrates: Collagen types I–IV and casein .

  • Plant xylem sap mimic: PD_0327 activity decreases by 40% in Zn-amended xylem sap (100 µM Zn²⁺), suggesting environmental regulation .

How do recombination events in X. fastidiosa affect PD_0327 evolution?

PD_0327 alleles show limited variation due to:

  • Negative selection pressure: dN/dS ratio < 0.3 for pd_0327 across 129 X. fastidiosa genomes .

  • Recombination barriers: Type I restriction-modification systems in X. fastidiosa suppress horizontal gene transfer of metalloprotease genes .

  • Strain-specific SNPs: Citrus-infecting X. fastidiosa subsp. pauca carries a Thr267→Ile mutation in PD_0327’s substrate-binding pocket .

What advanced imaging techniques characterize PD_0327’s spatial distribution in plant hosts?

  • Immunogold labeling: PD_0327 localizes to biofilm matrices in grapevine xylem vessels, not individual cells .

  • Microscopy correlation: Biofilm aggregates positive for PD_0327 (anti-His tag immunofluorescence) coincide with regions of Zn²⁺ accumulation (Zinpyr-1 staining) .

Why do PD_0327 homologs in Xanthomonas spp. lack Zn²⁺-responsive regulation?

Comparative analysis reveals:

  • Regulatory divergence: PD_0327 lacks the Xanthomonas-type Zur-binding upstream motif (5´-TAATGTAA-3´) .

  • Operon structure: pd_0327 is monocistronic in X. fastidiosa but part of a Zn²⁺-export operon in Xanthomonas campestris .

Can PD_0327 serve as a modular scaffold for engineering novel metalloproteases?

Rational design approaches include:

  • Domain swapping: Replacement of PD_0327’s β-sheet domain (aa 201-320) with Clostridium Zmp1’s collagen-binding module increases fibrinogen affinity 3-fold .

  • Metal cofactor substitution: Fe²⁺-substituted PD_0327 retains 22% activity but gains oxidative stability (t<sub>1/2</sub> = 48 hr vs. 12 hr for Zn²⁺ form) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.