Recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) is a protein encoded by the Yaba-like disease virus (YLDV) . YLDV is a member of the Yatapoxvirus genus, which can infect humans and other primates . The 5L protein functions as an E3 ubiquitin ligase, an enzyme that plays a crucial role in the ubiquitination process . Ubiquitination involves the attachment of ubiquitin to target proteins, affecting their function, localization, or degradation .

Ubiquitination and E3 Ubiquitin Ligases

Ubiquitination is a vital cellular process mediated by an enzymatic cascade . This process involves:

  1. E1 Ubiquitin-Activating Enzyme: Activates ubiquitin .

  2. E2 Ubiquitin-Conjugating Enzyme: Transfers activated ubiquitin .

  3. E3 Ubiquitin Ligase: Transfers ubiquitin to a lysine residue on the target protein, ensuring substrate specificity .

E3 ubiquitin ligases are categorized into three main types based on functional domains and ubiquitin transfer mechanisms :

  • RING E3s: The most abundant type, characterized by a zinc-binding RING domain or a U-box domain .

  • HECT Domain E3s: Characterized by a conserved HECT domain at the C-terminus .

  • RBR E3s: Defined by two RING domains (RING1 and RING2) and an in-between-RING domain (IBR) .

Poxviruses, including YLDV, encode various proteins with E3 ubiquitin ligase functions . These include PRANC, ANK/BC, BBK, P28/RING, and MARCH proteins .

Yaba-like Disease Virus (YLDV) and LAP (5L)

YLDV is a chordopoxvirus with a genome size of approximately 145,000 base pairs . The 5L protein, also known as leukemia-associated protein (LAP), is a 156 amino acid protein that functions as an E3 ubiquitin-protein ligase . It shares homology with the LAP protein of myxoma virus and is a membrane-bound E3 ubiquitin ligase .

Basic Information of 5L Protein

ItemDescription
Product CodeCSB-CF887621YAAO
Uniprot No.Q9DHV7
Target Names5L
Protein NamesE3 ubiquitin-protein ligase LAP
Expression Region1-156
SequenceMSDICWICNDVCDERNNFCGCNEEYKVVHIKCMQLWINYSKKKECNLCKTKYNIKKTYVSFKKWNWCFNDKKTTLFKIFFILFALVFIFLTITLSNDMANLVTGINDLICSIIFLIVYTVVMLTSICFSVFVVAIVVDFLLEAKEKNSFLTIREIV

Function and Significance

The E3 ubiquitin ligases encoded by poxviruses play crucial roles in the viral life cycle, particularly in host immune evasion . By modulating the ubiquitination of host cell proteins, these ligases can disrupt immune signaling pathways and prevent effective antiviral responses . For example, the myxoma virus M153 protein, a MARCH protein, ubiquitinates CD4, inhibiting the recognition of MHC-II molecules and suppressing the immune response .

While the precise substrates and functions of YLDV LAP (5L) are still under investigation, its identification as an E3 ubiquitin ligase suggests its involvement in similar immune evasion strategies . Further research into the specific targets of LAP (5L) will enhance our understanding of virus-host interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
5L; E3 ubiquitin-protein ligase LAP; Leukemia associated protein; LAP; RING-type E3 ubiquitin transferase LAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Yaba-like disease virus (YLDV)
Target Names
5L
Target Protein Sequence
MSDICWICNDVCDERNNFCGCNEEYKVVHIKCMQLWINYSKKKECNLCKTKYNIKKTYVS FKKWNWCFNDKKTTLFKIFFILFALVFIFLTITLSNDMANLVTGINDLICSIIFLIVYTV VMLTSICFSVFVVAIVVDFLLEAKEKNSFLTIREIV
Uniprot No.

Target Background

Function

Recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) is an E3 ubiquitin-protein ligase that promotes the ubiquitination and subsequent degradation of host MHC-I and CD4 molecules. This mechanism likely prevents the lysis of infected cells by cytotoxic T lymphocytes and NK cells. The protein binds target molecules through transmembrane interactions. Ubiquitination enhances the endocytosis of the target molecule, leading to its lysosomal degradation.

Database Links

KEGG: vg:918655

Protein Families
Poxviridae LAP protein family
Subcellular Location
Host membrane; Multi-pass membrane protein. Host Golgi apparatus, host trans-Golgi network membrane. Host early endosome membrane.

Q&A

What is Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L)?

Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L), also known as Leukemia Associated Protein (LAP), is a viral enzyme that catalyzes the transfer of ubiquitin to target proteins. This protein belongs to the family of E3 ubiquitin ligases encoded by poxviruses and plays a significant role in viral immune evasion mechanisms. The recombinant form is typically produced in E. coli expression systems and is available as a partial protein for research purposes . The protein has a UniProt accession number of Q9DHV7 and functions within the ubiquitin-proteasome pathway, potentially targeting host immune components for degradation .

How does the structure of Yaba-like disease virus E3 ubiquitin ligase compare to other poxvirus E3 ligases?

Poxvirus E3 ubiquitin ligases are categorized into five distinct structural families based on their functional domains and ubiquitin transfer mechanisms: PRANC, ANK/BC, BBK, P28/RING, and MARCH proteins . Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) likely shares structural similarities with other poxvirus RING-domain containing E3 ligases. The RING domain is characterized by a zinc-binding motif that is crucial for the recruitment of ubiquitin-charged E2 enzymes . Unlike cellular RING E3s that often function as multi-subunit complexes, poxvirus E3 ligases frequently operate as standalone proteins with specialized domains for both substrate recognition and catalytic activity . This structural adaptation allows for targeted manipulation of host immune pathways.

What are the optimal storage conditions for recombinant 5L protein?

For optimal stability and activity retention of recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L), the following storage conditions are recommended:

FormStorage TemperatureShelf Life
Lyophilized-20°C to -80°C12 months
Liquid-20°C to -80°C6 months
Working aliquots4°CUp to one week

The shelf life is influenced by multiple factors including buffer composition, storage state, temperature, and the inherent stability properties of the protein itself . To maintain protein integrity, repeated freeze-thaw cycles should be strictly avoided. For long-term storage, it is advisable to prepare small aliquots supplemented with 5-50% glycerol (with 50% being the standard recommended concentration) to prevent degradation during the freezing process .

How should recombinant 5L protein be reconstituted for experimental use?

For proper reconstitution of lyophilized recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L), follow this methodological approach:

  • Briefly centrifuge the vial prior to opening to collect the contents at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the standard recommendation)

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • Store the reconstituted protein according to the temperature guidelines outlined in section 2.1

The reconstitution buffer may be adjusted based on specific experimental requirements, but care should be taken to ensure buffer compatibility with downstream applications. For enzymatic activity assays, consider using buffer systems that maintain optimal pH for ubiquitin ligase activity (typically pH 7.5-8.0).

What quality control measures are used to assess recombinant 5L protein purity?

Quality control of recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) typically employs SDS-PAGE analysis to assess protein purity, with commercial preparations generally achieving >85% purity . Additional quality control methods might include:

  • Western blotting to confirm protein identity

  • Mass spectrometry for precise molecular weight determination and sequence verification

  • Activity assays to verify functional enzymatic capacity

  • Endotoxin testing to ensure suitability for immunological experiments

When designing experiments, researchers should consider that the recombinant protein is a partial form of the native viral protein, and its tag type may vary depending on the manufacturing process . Therefore, experimental controls should be implemented to account for potential tag-related effects on protein function or interaction studies.

How does Yaba-like disease virus E3 ubiquitin ligase contribute to viral immune evasion?

Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) likely functions as part of the virus's immune evasion strategy, similar to other poxvirus E3 ubiquitin ligases. These viral enzymes specifically target components of the host innate immune system for ubiquitination and subsequent degradation via the proteasome pathway . This mechanism allows the virus to counteract host defense mechanisms and establish productive infection.

The strategic targeting of host immunity by viral E3 ligases typically follows specific patterns:

  • Degradation of pattern recognition receptors (PRRs) that detect viral infection

  • Targeting of signaling intermediates in antiviral pathways

  • Ubiquitination of transcription factors involved in interferon responses

  • Manipulation of DNA damage response pathways that may restrict viral replication

While the specific cellular targets of the Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) remain to be fully characterized, research on related poxvirus E3 ligases suggests they play crucial roles in manipulating ubiquitin-dependent cellular processes to create a favorable environment for viral replication and spread .

What experimental approaches can be used to identify substrates of viral E3 ubiquitin ligases?

Identifying the cellular substrates of viral E3 ubiquitin ligases like the Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) requires multi-faceted experimental approaches:

  • Proteomics-based approaches:

    • Quantitative proteomics comparing ubiquitinome changes in the presence vs. absence of viral E3 ligase

    • Stable isotope labeling with amino acids in cell culture (SILAC) to track protein degradation

    • Proximity-dependent biotin identification (BioID) to capture transient enzyme-substrate interactions

  • Biochemical strategies:

    • In vitro ubiquitination assays with candidate substrates

    • Co-immunoprecipitation studies followed by mass spectrometry analysis

    • GST-pulldown experiments to identify phosphorylation-dependent interactions, similar to the approach used for studying HSV-1 ICP0 interactions with RNF8

  • Genetic screening:

    • siRNA screening to identify cellular factors involved in viral E3 ligase function

    • CRISPR-Cas9 screens to identify essential host factors

  • Structural biology:

    • Crystal structure determination of viral E3 ligase complexes with potential substrates

    • Molecular docking studies to predict protein-protein interactions

These approaches have successfully identified substrates for other viral E3 ligases, such as the HSV-1 ICP0 targeting of RNF8 and RNF168, which are components of the DNA damage response pathway .

How do phosphorylation events regulate viral E3 ubiquitin ligase activity?

Phosphorylation plays a critical regulatory role in the function of viral E3 ubiquitin ligases, as demonstrated by studies on HSV-1 ICP0. These phosphorylation events can regulate substrate recognition, enzyme activation, and cellular localization. Key insights from research on viral E3 ligases include:

  • Substrate recognition regulation:
    Phosphorylation of viral E3 ligases can create binding motifs recognized by cellular proteins, as seen with HSV-1 ICP0. The phosphorylation of ICP0 at threonine 67 by casein kinase 1 (CK1) creates a binding site for the forkhead-associated (FHA) domain of RNF8, recruiting this cellular E3 ligase for degradation . This phosphorylation-dependent mechanism allows precise targeting of specific host proteins.

  • Activity modulation:
    Phosphorylation states can determine the catalytic activity of E3 ligases, functioning as molecular switches that control ubiquitination processes. Dephosphorylation with alkaline phosphatase treatment has been shown to disrupt interactions between viral E3 ligases and their targets .

  • Spatiotemporal regulation:
    Phosphorylation can control the subcellular localization of viral E3 ligases, ensuring they encounter their substrates at the appropriate time and cellular compartment during infection.

This phosphorylation-dependent regulatory mechanism represents a sophisticated viral strategy that mimics and exploits host cellular processes, allowing viruses to precisely time the degradation of host defense factors according to their replication cycle needs .

How can structural differences between poxvirus E3 ligases be exploited for therapeutic development?

The structural diversity among poxvirus E3 ubiquitin ligases presents opportunities for targeted therapeutic development. These approaches build upon the unique characteristics of each ligase family:

  • Targeting conserved catalytic domains:
    RING domains in poxvirus E3 ligases like the Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) contain zinc-coordinating residues essential for catalytic activity. Small molecule inhibitors that disrupt zinc coordination or prevent E2 enzyme recruitment could selectively inhibit viral E3 ligases while minimizing effects on host enzymes .

  • Exploiting unique substrate recognition mechanisms:
    Unlike many cellular RING E3s that function within multi-subunit complexes, poxvirus E3 ligases often operate as standalone proteins with specialized domains. Therapeutic agents that interfere with these virus-specific substrate recognition domains could prevent immune evasion while preserving normal cellular ubiquitination processes .

  • Developing allosteric inhibitors:
    Poxvirus E3 ligases often contain virus-specific regulatory regions absent in host counterparts. These unique allosteric sites could be targeted to develop highly selective inhibitors with minimal off-target effects on cellular ubiquitination pathways.

  • Peptide-based competitive inhibitors:
    Peptides mimicking the binding interface between viral E3 ligases and their cellular targets could competitively inhibit pathologically relevant ubiquitination events. Such approaches have shown promise in disrupting protein-protein interactions essential for viral replication .

Understanding the structural basis of substrate recognition by various poxvirus E3 ligase families is crucial for developing targeted antivirals with high specificity and reduced potential for resistance development.

What are the evolutionary implications of poxviruses acquiring E3 ubiquitin ligase functions?

The acquisition and evolution of E3 ubiquitin ligase functions by poxviruses represent a fascinating example of molecular adaptation during host-pathogen coevolution. This evolutionary process involves several key mechanisms and consequences:

  • Gene acquisition through horizontal transfer:
    Poxviruses have incorporated host cell genes into their genomes through horizontal gene transfer events, subsequently adapting these genes to promote viral replication and immune evasion. This incorporation of host ubiquitination machinery represents a sophisticated evolutionary strategy that allows viruses to manipulate cellular processes using familiar molecular tools .

  • Functional diversity through domain recombination:
    Poxvirus E3 ligases exhibit considerable structural and functional diversity, suggesting that domain recombination and shuffling have played important roles in their evolution. The five distinct structural families of poxvirus E3 ligases (PRANC, ANK/BC, BBK, P28/RING, and MARCH) likely arose through independent acquisition events followed by diversification .

  • Selective pressure on immune evasion:
    The conservation of E3 ligase functions across poxvirus species, despite considerable genomic diversity, indicates strong selective pressure to maintain these immune evasion mechanisms. This pattern suggests that ubiquitin-mediated degradation of host immune factors represents a fundamental requirement for successful poxvirus infection .

  • Host-range determination:
    The specificity of viral E3 ligases for particular host factors may contribute to determining virus host range and tissue tropism. Mutations in viral E3 ligases could potentially expand or restrict the range of susceptible hosts or tissues .

This evolutionary perspective provides insights into the remarkable adaptability of poxviruses and highlights potential vulnerabilities that might be exploited for therapeutic intervention.

How can recombinant 5L protein be used to study the mechanisms of viral immune evasion?

Recombinant Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L) serves as a valuable research tool for investigating mechanisms of viral immune evasion through carefully designed experimental approaches:

  • In vitro ubiquitination assays:

    • Reconstitute complete ubiquitination reactions using purified recombinant 5L protein, E1 activating enzyme, E2 conjugating enzyme, ubiquitin, and candidate substrate proteins

    • Analyze ubiquitination patterns using western blotting with anti-ubiquitin antibodies

    • Employ mass spectrometry to identify specific lysine residues targeted for ubiquitination

    • Compare wild-type recombinant 5L with catalytically inactive mutants to confirm specificity

  • Cell-based functional studies:

    • Express recombinant 5L protein in mammalian cells and analyze effects on immune signaling pathways

    • Evaluate changes in the abundance of candidate cellular targets using proteomics approaches

    • Assess impact on antiviral signaling using reporter assays for pathways such as type I interferon responses

    • Utilize fluorescently tagged 5L to track subcellular localization during different stages of immune activation

  • Structural analysis approaches:

    • Perform X-ray crystallography or cryo-electron microscopy studies of 5L protein in complex with substrates

    • Use hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Conduct molecular dynamics simulations to understand the conformational dynamics during substrate recognition

  • Comparative analysis with other viral E3 ligases:

    • Compare substrate specificity and catalytic efficiency of 5L with related E3 ligases from other poxviruses

    • Investigate whether different poxvirus E3 ligases target complementary or redundant host immune pathways

    • Evaluate the potential for cross-reactivity or interference between viral and host E3 ligases

These methodological approaches can reveal critical insights into how poxviruses manipulate host ubiquitination machinery to establish productive infection and evade immune detection.

What are the current limitations in studying viral E3 ubiquitin ligases?

Research on viral E3 ubiquitin ligases, including Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L), faces several methodological and conceptual challenges:

  • Substrate identification barriers:

    • Transient enzyme-substrate interactions make capturing authentic substrates difficult

    • Redundancy in viral targeting mechanisms may mask phenotypes when individual E3 ligases are deleted

    • Cell-type specific effects may be overlooked in commonly used laboratory cell lines

    • The dynamic nature of ubiquitination during different stages of infection complicates temporal analysis

  • Technical limitations:

    • Recombinant viral E3 ligases may lack critical post-translational modifications present during infection

    • Partial protein constructs (like the available recombinant 5L) may not fully recapitulate native activity

    • In vitro ubiquitination assays may not reflect the complex cellular environment

    • Distinguishing direct from indirect effects of viral E3 ligase activity remains challenging

  • Knowledge gaps:

    • The regulation of viral E3 ligase activity during different phases of infection is poorly understood

    • Structural mechanisms of substrate recognition for many viral E3 ligases remain uncharacterized

    • The interplay between viral E3 ligases and cellular deubiquitinating enzymes is largely unexplored

    • Comprehensive understanding of the ubiquitinome changes during infection is lacking

Addressing these limitations requires interdisciplinary approaches combining structural biology, proteomics, advanced imaging, and systems biology to fully understand the complex role of viral E3 ligases in pathogenesis.

What emerging technologies are advancing research on viral E3 ubiquitin ligases?

Research on viral E3 ubiquitin ligases is being revolutionized by several cutting-edge technologies that address previous methodological limitations:

  • Advanced proteomics approaches:

    • Ubiquitin remnant profiling using K-ε-GG antibodies enables global identification of ubiquitination sites

    • Proximity-dependent labeling methods (BioID, TurboID) capture transient enzyme-substrate interactions

    • Targeted proteomics with parallel reaction monitoring allows quantification of low-abundance ubiquitinated species

    • Crosslinking mass spectrometry provides structural insights into E3-substrate complexes

  • CRISPR-based technologies:

    • Genome-wide CRISPR screens identify host factors required for viral E3 ligase function

    • Base editing and prime editing enable precise modification of catalytic residues without disrupting protein expression

    • CRISPRi/CRISPRa systems allow temporal control of host factor expression during infection

    • CRISPR-based imaging permits visualization of dynamic E3-substrate interactions in living cells

  • Structural biology innovations:

    • Cryo-electron microscopy enables visualization of flexible E3 ligase complexes in multiple conformational states

    • Integrative structural biology combines multiple experimental approaches to model complete E3 ligase systems

    • AlphaFold and related AI methods predict structures of viral E3 ligases and their complexes

    • Time-resolved structural methods capture the dynamic process of ubiquitin transfer

  • Single-cell technologies:

    • Single-cell proteomics reveals cell-to-cell variability in ubiquitination responses during infection

    • Spatial transcriptomics maps the tissue-specific activity of viral E3 ligases in complex organs

    • Live-cell imaging with engineered ubiquitin sensors tracks ligase activity in real-time

These technologies are transforming our understanding of how viruses like Yaba-like disease virus manipulate the host ubiquitination machinery during infection.

How might understanding viral E3 ubiquitin ligases contribute to broader therapeutic applications?

Research on viral E3 ubiquitin ligases, including Yaba-like disease virus E3 ubiquitin-protein ligase LAP (5L), has far-reaching implications for therapeutic development beyond direct antiviral applications:

  • Novel antiviral strategies:

    • Structure-based design of selective inhibitors targeting viral E3 ligase catalytic domains

    • Development of stapled peptides that disrupt specific E3-substrate interactions

    • Creation of proteolysis-targeting chimeras (PROTACs) that redirect viral E3 ligases to degrade viral proteins

    • Identification of host factors that could be temporarily modulated to prevent viral E3 ligase function

  • Immunomodulatory applications:

    • Engineering of viral E3 ligases as controllable tools to temporarily suppress specific immune pathways in autoimmune diseases

    • Development of vaccines incorporating inactivated viral E3 ligases to generate immunity against conserved viral proteins

    • Exploitation of viral mechanisms to develop therapeutic approaches for targeted degradation of disease-causing proteins

    • Design of chimeric immunity regulators based on viral E3 ligase targeting mechanisms

  • Research tools and biotechnology applications:

    • Utilization of substrate specificity mechanisms for developing research tools to study ubiquitination

    • Adaptation of viral E3 ligase targeting strategies for controlled protein degradation in synthetic biology applications

    • Engineering of synthetic viral-inspired E3 ligases with novel substrate specificities for research and therapeutic applications

    • Development of biosensors based on E3-substrate interactions for detecting specific cellular states

The molecular mechanisms discovered through studying viral E3 ligases provide invaluable insights into fundamental cellular processes and reveal novel strategies for therapeutic intervention across multiple disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.