Recombinant Yaba monkey tumor virus E3 ubiquitin-protein ligase LAP (LAP)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of LAP

LAP is a transmembrane protein encoded by the YMTV genome (strain VR587). Key structural and biochemical properties include:

PropertyDetailsSource
Uniprot AccessionQ6TV02
Protein LengthFull-length (1–156 amino acids)
TagN-terminal 10xHis-tag
Expression SystemIn vitro E. coli
SequenceMSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHY... (full sequence provided in sources)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C for long-term; 4°C for short-term aliquots

Functional Insights and Mechanistic Roles

LAP belongs to the E3 ubiquitin-protein ligase family, which facilitates the addition of ubiquitin to target proteins. While specific substrates and mechanisms remain under investigation, its classification as an E3 ligase suggests roles in:

  • Protein Degradation: Tagging cellular or viral proteins for proteasomal degradation.

  • Viral Immune Evasion: Modulating host immune responses by targeting immune-related proteins.

  • Viral Replication: Regulating processes critical for viral assembly or host cell adaptation.

Key Observations:

  • Structural Features: The N-terminal region contains motifs associated with transmembrane domains, while the C-terminal region may harbor catalytic domains typical of E3 ligases (e.g., RING or U-box domains) .

  • Homology: LAP shares functional similarities with other poxviral E3 ligases, such as ectromelia virus (ECTV) p28, which uses a RING domain for ubiquitination .

Research Applications and Experimental Utilities

LAP is utilized in diverse experimental contexts, including:

ApplicationDetailsSource
ELISA AssaysDetects anti-LAP antibodies in sera or purified samples.
Protein Interaction StudiesIdentifies LAP-binding partners (e.g., ubiquitin-conjugating enzymes).
Ubiquitination AssaysEvaluates E3 ligase activity in vitro or in vivo.
Structural BiologyX-ray crystallography or cryo-EM to resolve domain-specific interactions.

Experimental Notes:

  • Handling: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

  • Stability: Lyophilized forms retain activity for 12 months at -20°C/-80°C .

Comparative Analysis with Other Poxviral E3 Ligases

LAP’s role in YMTV infection parallels that of other poxviral E3 ligases, such as:

ProteinVirusKey FunctionSource
p28Ectromelia virusVirulence factor; targets host proteins.
M153Myxoma virusLysosomal degradation of immune receptors.
LAPYMTVUbiquitination (exact substrates undefined).

Critical Differences:

  • Genomic Context: LAP is a single-copy gene in YMTV, unlike avipoxviruses (e.g., fowlpox virus), which encode multiple E3 ligases .

  • Immune Modulation: Unlike K3 orthologs (e.g., TPV 012/YMTV 012), which inhibit PKR, LAP’s role in immune evasion remains uncharacterized .

Challenges and Future Directions

While LAP’s recombinant production is well-documented, gaps persist in understanding its:

  1. Substrate Specificity: Identification of cellular or viral targets for ubiquitination.

  2. Pathogenic Role: Contribution to YMTV tumor formation or immune evasion.

  3. Therapeutic Potential: Utility as a target for antiviral therapies.

Research Priorities:

  • Structural Studies: Resolve LAP’s catalytic domain architecture.

  • Functional Screens: Use CRISPR/Cas9 or siRNA to identify interacting partners.

  • In Vivo Models: Assess LAP’s impact on YMTV replication in non-human primates.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
LAP; 5L; E3 ubiquitin-protein ligase LAP; Leukemia associated protein; LAP; RING-type E3 ubiquitin transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Yaba monkey tumor virus (strain VR587) (YMTV)
Target Names
LAP
Target Protein Sequence
MSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHY FSRWKWCFSDKKTVLSKILFIFFAVGFIFITTSMSSNVASLVTRIDDTFFDVVFLTVYIS MILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV
Uniprot No.

Target Background

Function

Recombinant Yaba monkey tumor virus E3 ubiquitin-protein ligase LAP (LAP) is an E3 ubiquitin-protein ligase that promotes the ubiquitination and subsequent degradation of host MHC-I and CD4 molecules. This mechanism likely prevents lysis of infected cells by cytotoxic T-lymphocytes and NK cells. LAP binds target molecules via transmembrane interaction. Ubiquitination enhances endocytosis of the target chain, leading to lysosomal delivery and proteolytic destruction.

Database Links

KEGG: vg:2943673

Protein Families
Poxviridae LAP protein family
Subcellular Location
Host membrane; Multi-pass membrane protein. Host Golgi apparatus, host trans-Golgi network membrane. Host early endosome membrane.

Q&A

What is Yaba monkey tumor virus E3 ubiquitin-protein ligase LAP and what is its biological significance?

The Yaba monkey tumor virus (YMTV) E3 ubiquitin-protein ligase LAP (Leukemia Associated Protein) is a virulence factor encoded by the YMTV, a member of the Yatapoxvirus genus of poxviruses . This protein is encoded by the 5L gene of YMTV and functions as an E3 ubiquitin ligase with EC classification 6.3.2.- .

LAP's biological significance lies in its role as a virulence factor potentially involved in immunosuppression mechanisms that facilitate YMTV pathogenesis. Research with similar proteins in related poxviruses, such as Myxoma virus leukemia-associated protein (MV-LAP), has demonstrated its involvement in MHC class I downregulation and inhibition of cytotoxic T lymphocyte (CTL) activity . These functions help the virus evade host immune responses, particularly cell-mediated immunity, which is critical for the virus's ability to establish infection and form characteristic tumor-like lesions.

How is recombinant YMTV E3 ubiquitin-protein ligase LAP typically produced for research applications?

Recombinant YMTV E3 ubiquitin-protein ligase LAP is typically produced using in vitro expression systems. Based on the available literature and product information, the most common methods include:

  • Bacterial expression systems: E. coli-based expression is frequently used, as indicated in product specifications . The protein is often tagged with an N-terminal 10xHis-tag to facilitate purification.

  • Baculovirus expression systems: For studies requiring post-translational modifications or membrane protein expression, insect cell-based baculovirus expression systems may be employed. This approach has been used for related poxviral proteins, as seen in research with YMTV 14L protein .

The methodology typically involves:

  • PCR amplification of the LAP gene from YMTV genomic DNA

  • Cloning into appropriate expression vectors (with or without signal sequences)

  • Expression in the chosen system

  • Purification using affinity chromatography based on the fusion tag

  • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

For active enzyme studies, it is recommended to use fresh preparations and avoid repeated freeze-thaw cycles, with working aliquots stored at 4°C for up to one week .

What are the optimal conditions for handling and storing recombinant YMTV E3 ubiquitin-protein ligase LAP in laboratory settings?

For optimal handling and storage of recombinant YMTV E3 ubiquitin-protein ligase LAP, researchers should consider the following evidence-based guidelines:

Storage conditions:

  • Store stock solutions at -20°C for routine use

  • For extended storage periods, maintain at -80°C to maximize protein stability and enzymatic activity

  • Use a Tris-based buffer with 50% glycerol as a cryoprotectant to prevent denaturation during freeze-thaw cycles

Working with the protein:

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

  • When designing experiments, consider the transmembrane nature of the protein, which may affect solubility and functionality

Stability considerations:

  • The shelf life in liquid form is typically 6 months at -20°C/-80°C

  • Lyophilized preparations demonstrate extended stability, with a shelf life of approximately 12 months at -20°C/-80°C

  • Protein stability can be affected by buffer ingredients and storage temperature

Researchers should validate protein activity after extended storage periods using appropriate functional assays, particularly when investigating E3 ubiquitin ligase activity.

What are the recommended experimental approaches for studying the E3 ubiquitin ligase activity of recombinant YMTV LAP?

When investigating the E3 ubiquitin ligase activity of recombinant YMTV LAP, researchers should consider the following experimental approaches:

In vitro ubiquitination assays:

  • Components required:

    • Purified recombinant YMTV LAP protein

    • E1 activating enzyme

    • E2 conjugating enzyme (test multiple E2s to identify preferred partners)

    • Ubiquitin (consider using tagged versions for detection)

    • ATP and Mg²⁺

    • Potential substrate proteins (based on hypothesized targets)

  • Protocol overview:

    • Combine components in reaction buffer

    • Incubate at 30-37°C for 1-2 hours

    • Analyze by SDS-PAGE and Western blotting

    • Detect ubiquitinated products using anti-ubiquitin antibodies

Substrate identification:

  • Immunoprecipitation approaches:

    • Express tagged LAP in relevant cell lines

    • Perform pull-down experiments followed by mass spectrometry

    • Validate interactions through reciprocal co-immunoprecipitation

  • Cellular ubiquitination targets:

    • Focus on MHC class I and immune signaling components based on known effects of related viral LAP proteins

    • Compare ubiquitination patterns in cells with and without LAP expression

    • Use proteasome inhibitors to stabilize ubiquitinated intermediates

Functional validation:

  • Site-directed mutagenesis:

    • Create RING domain mutants (e.g., targeting conserved cysteines in CWICND and FCICSE motifs)

    • Test effects on ubiquitination activity and substrate binding

  • Cellular assays:

    • Measure MHC-I downregulation using flow cytometry

    • Assess CTL killing assays using methodologies similar to those described for MV-LAP

    • Evaluate effects on immune signaling pathways

These approaches should be adapted based on specific research questions and available resources, with appropriate controls included in all experimental designs.

How can researchers effectively use recombinant YMTV LAP in immunological assays to study viral immune evasion?

To effectively use recombinant YMTV LAP in immunological assays studying viral immune evasion, researchers should consider the following methodological approaches:

MHC Class I downregulation assays:

  • Flow cytometry analysis:

    • Transfect or transduce cells with LAP expression constructs

    • After 24-48 hours, stain with anti-MHC-I antibodies (e.g., anti-HLA-A, -B, -C for human cells)

    • Analyze MHC-I surface expression by flow cytometry

    • Include appropriate controls (empty vector, inactive LAP mutants)

    • This approach mirrors successful studies with MV-LAP that demonstrated MHC-I downregulation

  • Confocal microscopy:

    • Use fluorescently tagged MHC-I and LAP constructs

    • Visualize subcellular localization and potential co-localization

    • Track MHC-I trafficking in the presence of LAP

CTL recognition and killing assays:

  • Cytotoxicity assays:

    • Generate target cells expressing LAP and appropriate antigens

    • Co-culture with antigen-specific CTLs

    • Measure cell lysis using chromium release or fluorescent dye-based assays

    • Previous research with MV-LAP demonstrated abolishment of cytotoxic activity when expressed in target cells

  • T cell activation assays:

    • Measure IFN-γ secretion from CTLs exposed to LAP-expressing APCs

    • Analyze T cell activation markers (CD69, CD25) by flow cytometry

Antigen presentation pathway analysis:

  • Pulse-chase experiments:

    • Track MHC-I synthesis, assembly, and trafficking in LAP-expressing cells

    • Use biochemical approaches to identify which step(s) in the pathway are affected

  • Proteasome activity assays:

    • Determine if LAP affects ubiquitin-proteasome function relevant to antigen processing

    • Use fluorogenic substrates to measure proteasomal activity

Comparative analysis with other viral immune evasion proteins:

  • Parallel testing with related proteins:

    • Compare LAP effects with other viral proteins known to target MHC-I (e.g., KSHV K3/K5)

    • Evaluate potential synergistic effects when co-expressed with other YMTV immune evasion proteins, such as the 14L protein which functions as an IL-18 binding protein

These approaches provide a comprehensive framework for investigating the immunomodulatory functions of YMTV LAP in different experimental systems.

How does YMTV LAP compare functionally with other viral E3 ubiquitin ligases, particularly those from related poxviruses?

A comprehensive functional comparison between YMTV LAP and other viral E3 ubiquitin ligases reveals both shared mechanisms and unique properties:

Comparison with MV-LAP (Myxoma virus):
The most extensively studied related protein is MV-LAP from Myxoma virus, which demonstrates several functional parallels:

  • Both function as virulence factors - MV-LAP deletion mutants (MV-ΔLAP) show significantly reduced virulence with mortality rates decreasing from 100% to approximately 30%

  • Both affect MHC-I expression - MV-LAP induces MHC-I downregulation in infected cells

  • Both inhibit CTL-mediated killing - MV-LAP abolishes cytotoxic activity against infected target cells

  • Both likely target similar components of the antigen presentation pathway

Comparison with other poxvirus E3 ligases:

  • K3/K5 from KSHV (a herpesvirus): While not poxviral proteins, these are well-characterized viral E3 ligases that downregulate MHC-I through ubiquitination of the cytoplasmic tail. LAP may employ similar mechanisms but with distinct structural features

  • p28 (ECTV): Encoded by ectromelia virus, this protein has E3 ubiquitin ligase activity but primarily targets cellular conjugating enzymes rather than MHC components

  • RING-CH proteins: LAP belongs to a broader family of viral RING-CH-containing E3 ligases that have evolved to target immune recognition molecules

Unique aspects of YMTV LAP:

  • Unlike some related proteins, LAP appears specifically adapted to the unique pathogenesis of YMTV, which causes distinctive histiocytomas rather than the widespread necrotic lesions seen with many other poxviruses

  • The tumor-forming capability of YMTV suggests LAP may have additional functions beyond immune evasion, potentially affecting cell proliferation or apoptosis pathways

These comparative insights help position YMTV LAP within the broader context of viral immune evasion strategies and highlight its potential unique contributions to YMTV pathogenesis.

What are the recommended approaches for studying the role of YMTV LAP in histiocytoma formation and tumor development?

To investigate YMTV LAP's role in histiocytoma formation and tumor development, researchers should consider these evidence-based methodological approaches:

In vitro cell transformation models:

  • Histiocyte/macrophage cell cultures:

    • Express LAP in primary monocyte/macrophage lineage cells or appropriate cell lines

    • Assess changes in cell proliferation, morphology, and activation status

    • Evaluate transformation markers (focus formation, growth in soft agar, etc.)

    • This approach aligns with observations that YMTV primarily infects histiocytes that migrate to infection sites, proliferate, and form polyclonal tumors

  • 3D organoid cultures:

    • Develop skin equivalent models incorporating dermal fibroblasts, keratinocytes, and histiocytes

    • Introduce LAP expression constructs or YMTV infection

    • Monitor histiocytoma-like formation and cellular interactions

Molecular pathway analysis:

  • Transcriptomic and proteomic profiling:

    • Compare gene/protein expression profiles between LAP-expressing and control cells

    • Focus on pathways related to cell cycle regulation, proliferation, and inflammatory responses

    • Identify LAP-dependent changes in ubiquitination patterns using ubiquitin proteomics

  • Signaling pathway interrogation:

    • Evaluate activation status of relevant pathways (NF-κB, MAPK, JAK-STAT)

    • Use pathway inhibitors to determine which are essential for LAP-mediated effects

    • Analyze cell cycle progression using flow cytometry and cyclin expression

In vivo models:

  • Recombinant virus approaches:

    • Generate LAP-deficient YMTV mutants

    • Compare tumor formation kinetics and characteristics with wild-type virus

    • Evaluate histopathological differences in tumor composition and growth patterns

  • Histological and immunohistochemical analysis:

    • Characterize infiltrating cell populations in YMTV-induced tumors

    • Compare wild-type versus LAP-deficient virus infections

    • Assess proliferation markers, apoptosis, and immune cell infiltration

    • This approach reflects observed differences in dermal inflammation patterns seen in LAP-deficient versus wild-type Myxoma virus infections

Comparative studies with human tumors:

  • Histiocytic disorders:

    • Compare molecular signatures of YMTV-induced histiocytomas with human histiocytic disorders

    • Investigate whether similar pathways are dysregulated

  • Transgenic models:

    • Develop tissue-specific LAP transgenic animals to assess oncogenic potential

These methodologies should help elucidate how LAP contributes to the distinctive histiocytoma formation characteristic of YMTV infection, which differs from the typical poxviral cytopathic effects.

What are the potential applications of recombinant YMTV LAP in developing novel antiviral strategies or cancer therapeutics?

The unique properties of recombinant YMTV LAP offer several promising applications for both antiviral development and cancer therapeutics:

Antiviral strategy development:

  • Structure-based drug design:

    • Targeting the RING domain of LAP with small molecule inhibitors

    • High-throughput screening of compound libraries against LAP E3 ligase activity

    • Development of peptidomimetics that interrupt LAP-substrate interactions

  • Immunomodulation countermeasures:

    • Antibodies or decoy receptors that neutralize LAP's immune evasion functions

    • Compounds that prevent LAP-mediated MHC-I downregulation

    • This approach is supported by evidence that LAP-deficient poxviruses show attenuated virulence

  • Broad-spectrum poxvirus inhibitors:

    • Targeting conserved functional motifs shared between LAP and other viral E3 ligases

    • This could potentially provide protection against multiple poxviruses, including emerging threats

Cancer therapeutic applications:

  • Oncolytic viral platforms:

    • YMTV shows natural tumor cell tropism, making it a candidate for oncolytic virotherapy

    • Engineered LAP-modified YMTV variants could selectively replicate in and destroy cancer cells

    • This application builds on findings that TK-deleted poxviruses (including those in the same family as YMTV) have demonstrated oncolytic activity against various human tumor cell lines

  • Understanding and targeting ubiquitination pathways in cancer:

    • LAP as a tool to identify novel E3 ligase substrates relevant to cancer biology

    • Developing targeted protein degradation approaches based on LAP mechanisms

    • Exploiting LAP's ability to modulate immune recognition for cancer immunotherapy

  • Immunotherapy enhancement:

    • Using knowledge of how LAP evades immune recognition to design better cancer immunotherapies

    • Developing combination approaches that counteract similar immune evasion strategies employed by tumors

Research tool applications:

  • Probing antigen presentation:

    • LAP as a molecular tool to dissect MHC-I presentation pathways

    • Identifying critical checkpoints in cellular immunity against both viruses and tumors

  • Ubiquitination pathway analysis:

    • LAP as a probe for studying E2-E3 interactions and substrate recognition

    • Engineered LAP variants to selectively target proteins for degradation (similar to PROTAC approaches)

These applications leverage our understanding of LAP's role in viral pathogenesis while exploiting its unique properties for therapeutic development.

What are the key considerations when interpreting functional assays involving recombinant YMTV LAP in different experimental systems?

When interpreting functional assays with recombinant YMTV LAP, researchers should carefully consider these critical factors:

Expression system influences:

  • Tag interference effects:

    • N-terminal His-tags (commonly used in commercial preparations ) may alter protein folding or function

    • Control experiments comparing tagged versus untagged versions are essential

    • Consider the location of tags relative to functional domains (RING domain activity may be particularly sensitive)

  • Post-translational modifications:

    • E. coli-expressed LAP (common in commercial preparations ) lacks eukaryotic post-translational modifications

    • These modifications may be critical for certain functions or interactions

    • Comparison with insect cell or mammalian cell expression systems is advisable for complete functional analysis

Cell type considerations:

  • Species-specific effects:

    • YMTV naturally infects primates, so LAP may show differential activity in human versus non-human primate cells

    • Rodent systems may not fully recapitulate LAP functions due to potential species-specific protein interactions

    • This is supported by observed differences in disease manifestation between species infected with YMTV

  • Cell lineage relevance:

    • LAP functions may differ between cell types (e.g., epithelial cells versus macrophages/histiocytes)

    • Histiocytes/macrophages are the primary cells involved in YMTV-induced tumors , making them particularly relevant for functional studies

Technical and experimental design factors:

  • Protein concentration effects:

    • Supraphysiological concentrations may cause non-specific or artifactual effects

    • Dose-response experiments are essential to establish physiologically relevant concentration ranges

    • Consider the estimated expression levels during natural infection as a reference point

  • Temporal considerations:

    • Some LAP effects may be transient or dependent on specific cell cycle phases

    • Time-course experiments are crucial for capturing the full spectrum of LAP activity

    • This is particularly relevant for ubiquitination events, which can be rapid and dynamic

  • Context dependency:

    • LAP may require other viral factors for full functionality in vivo

    • Comparison between isolated LAP expression and whole virus infection is important

    • Studies with MV-LAP demonstrated that its virulence functions are best observed in complete virus context

Comparative data interpretation:

  • Control selection:

    • Include appropriate controls such as:

      • Catalytically inactive LAP mutants

      • Related viral E3 ligases

      • Cellular E3 ligases with similar substrate specificity

  • Reconciling in vitro versus in vivo findings:

    • Cell culture results may not fully predict in vivo effects

    • Consider immune system complexity when interpreting immunomodulatory functions

How can researchers distinguish between direct effects of YMTV LAP and secondary consequences in complex cellular systems?

Distinguishing direct effects of YMTV LAP from secondary consequences in complex cellular systems requires rigorous experimental design and multiple complementary approaches:

Temporal analysis strategies:

  • Early time-point investigations:

    • Examine cellular changes immediately following LAP introduction (minutes to hours)

    • Use inducible expression systems to precisely control LAP expression timing

    • Primary effects typically manifest more rapidly than secondary consequences

    • Example protocol: Use tetracycline-inducible LAP expression and analyze changes at 30 minutes, 2 hours, 6 hours, and 24 hours post-induction

  • Pulse-chase approaches:

    • Track specific protein fate (e.g., MHC-I) in the presence of LAP

    • Determine whether LAP directly affects synthesis, assembly, trafficking, or degradation

    • This helps identify which pathway component is the direct target versus downstream effects

Biochemical interaction approaches:

  • Direct binding assays:

    • Co-immunoprecipitation with putative targets under conditions that preserve transient interactions

    • In vitro binding assays with purified components

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to LAP

  • In vitro reconstitution:

    • Purified component systems to test direct ubiquitination of candidate substrates

    • Minimal system containing E1, E2, LAP, ATP, ubiquitin, and potential substrate

    • Direct effects will be reproducible in such purified systems

Domain mutant approaches:

  • Structure-function analysis:

    • Generate LAP variants with mutations in specific functional domains

    • Correlate loss of specific interactions with particular cellular phenotypes

    • Catalog effects that disappear with RING domain mutations versus transmembrane region mutations

  • Separation-of-function mutants:

    • Identify variants that maintain some functions while losing others

    • These help delineate which downstream effects depend on specific LAP activities

Inhibitor and pathway perturbation studies:

  • Selective pathway inhibition:

    • Use specific inhibitors of cellular pathways potentially affected by LAP

    • If inhibiting a pathway blocks a LAP effect, that pathway likely mediates the effect

    • Example: Test proteasome inhibitors to determine if MHC-I downregulation requires proteasomal degradation

  • Genetic approaches:

    • CRISPR knockout of candidate mediators of LAP effects

    • Epistasis analysis to determine hierarchical relationships between LAP and cellular factors

Comprehensive -omics analysis:

  • Time-resolved proteomics:

    • Analyze global ubiquitination patterns at different time points after LAP expression

    • Identify the earliest modified proteins as potential direct targets

  • Integrated multi-omics:

    • Combine transcriptomics, proteomics, and ubiquitinomics data

    • Construct temporal pathway maps to distinguish initial events from cascading effects

    • Focus on changes that occur before transcriptional responses are possible

By implementing these approaches systematically, researchers can build a convincing case for direct versus indirect effects of YMTV LAP in complex cellular environments.

What statistical approaches are most appropriate for analyzing variability in experiments with recombinant YMTV LAP, particularly in immune response studies?

When analyzing variability in experiments with recombinant YMTV LAP, particularly in immune response studies, researchers should employ these statistical approaches tailored to the specific challenges of this research:

Addressing biological variability:

  • Mixed-effects models:

    • Account for both fixed effects (LAP treatment conditions) and random effects (donor/animal variability)

    • Particularly valuable for analyzing primary immune cell responses, which show high donor-to-donor variability

    • Example: When analyzing MHC-I downregulation across multiple primary cell donors, mixed-effects models can separate treatment effects from inherent donor differences

  • Repeated measures ANOVA:

    • Appropriate for time-course experiments tracking LAP effects over multiple timepoints

    • Accounts for correlation between measurements from the same experimental unit

    • Critical for capturing the dynamic nature of immune responses to LAP

Managing technical variability:

  • Normalization strategies:

    • Use appropriate housekeeping controls for gene expression studies

    • For flow cytometry data, employ fluorescence minus one (FMO) controls and median fluorescence intensity (MFI) ratio normalization

    • Consider using multiple normalization approaches and reporting concordant findings

  • Robust statistical methods:

    • Non-parametric tests when data doesn't meet normality assumptions

    • Bootstrapping approaches to generate confidence intervals without assuming specific distributions

    • Particularly important for small sample sizes often encountered in complex immune assays

Multi-parameter data analysis:

  • Multivariate approaches:

    • Principal component analysis (PCA) or t-SNE for high-dimensional flow cytometry or mass cytometry data

    • These methods can reveal patterns in immune cell populations affected by LAP that might not be apparent in univariate analyses

    • Example application: Analyzing how LAP affects multiple immune cell subsets simultaneously in co-culture experiments

  • Multiple testing corrections:

    • Use Benjamini-Hochberg procedure for controlling false discovery rate in high-throughput studies

    • Apply family-wise error rate corrections (e.g., Bonferroni) for critical confirmatory experiments

    • Clearly report both uncorrected and corrected p-values for transparency

Experimental design considerations:

  • Power analysis:

    • Conduct a priori power calculations based on expected effect sizes from preliminary data

    • For LAP immune evasion studies, MHC-I downregulation typically shows moderate to large effect sizes (Cohen's d ≈ 0.8-1.2) based on similar viral proteins

    • Determine minimal sample sizes needed for detecting biologically meaningful effects

  • Biological replicates versus technical replicates:

    • Emphasize biological replicates (independent experiments) over technical replicates

    • For cell line studies, perform at least 3 independent experiments

    • For primary cell studies, include cells from at least 5-6 different donors to account for genetic variation

Advanced approaches for specific applications:

  • Dose-response modeling:

    • Four-parameter logistic regression for dose-dependent effects of LAP

    • Determine EC50 values for different LAP functions (e.g., MHC-I downregulation, CTL evasion)

    • Compare potency across different experimental systems

  • Survival analysis techniques:

    • Kaplan-Meier curves and log-rank tests for animal studies comparing wild-type versus LAP-deficient viruses

    • Cox proportional hazards models to account for covariates in virulence studies

    • These approaches effectively captured the difference in mortality rates between wild-type (100%) and LAP-deficient (30%) Myxoma virus infections

Implementing these statistical approaches will help researchers generate robust, reproducible data when studying the complex immunomodulatory effects of YMTV LAP.

What are the most promising avenues for further investigating YMTV LAP's role in viral pathogenesis and immune evasion?

Based on current knowledge gaps and technical capabilities, these research directions represent the most promising avenues for advancing our understanding of YMTV LAP:

Structural biology approaches:

  • High-resolution structure determination:

    • Solve the crystal or cryo-EM structure of LAP alone and in complex with substrates

    • Map the E2 binding interface and substrate recognition domains

    • Identify structural features that distinguish LAP from cellular E3 ligases

    • This would significantly advance structure-based inhibitor design efforts

  • Structure-function correlations:

    • Generate a library of structure-guided mutants

    • Map critical residues for various LAP functions

    • Establish the structural basis for target specificity

Substrate and pathway identification:

  • Comprehensive ubiquitinome analysis:

    • Compare global ubiquitination patterns in LAP-expressing versus control cells

    • Use quantitative proteomics to identify proteins with altered abundance

    • Apply proximity labeling techniques to identify LAP's local interaction network

    • This approach could reveal novel immune pathways targeted by YMTV

  • Immune signaling pathway interrogation:

    • Investigate LAP's effects on pattern recognition receptor pathways

    • Examine interactions with cytokine signaling networks beyond MHC-I

    • Determine if LAP affects NK cell recognition in addition to T cell evasion

Virus-host co-evolution studies:

  • Comparative analysis across primate species:

    • Test LAP function in cells from various primate species (rhesus, cynomolgus, vervet, human)

    • Identify host-specific adaptations in LAP's activity

    • This is particularly relevant given YMTV's documented infection of various primate species, including recently identified vervet monkey cases

  • Evolutionary analysis of LAP across poxvirus species:

    • Compare LAP sequences and functions across the Yatapoxvirus genus

    • Identify conserved versus variable regions that might indicate selective pressure

    • Correlate functional differences with host range and pathogenesis

Clinical and translational research:

  • Biomarker development:

    • Investigate whether anti-LAP antibodies could serve as diagnostic markers

    • Develop assays for LAP detection in clinical samples

    • This could improve diagnosis of YMTV infections, which have been documented in humans with mild symptoms

  • Antiviral development:

    • Screen for small molecule inhibitors of LAP E3 ligase activity

    • Test whether LAP inhibition reduces YMTV replication or pathogenesis

    • Evaluate cross-protection potential against related poxviruses

Novel experimental systems:

  • Organoid models:

    • Develop skin and immune organoids for studying LAP function

    • Create humanized mouse models expressing relevant human immune components

    • These systems would better recapitulate the complex tissue environment of YMTV infection

  • Single-cell analysis:

    • Apply single-cell RNA-seq to infected tissues

    • Track cell-type specific responses to LAP expression

    • Identify heterogeneity in LAP effects across different immune cell populations

These research directions would address fundamental questions about LAP's role in YMTV pathogenesis while potentially yielding translational insights for antiviral development and immune modulation strategies.

How might advances in CRISPR gene editing and synthetic biology be applied to study the function of YMTV LAP?

Advanced genetic engineering technologies offer powerful new approaches to investigate YMTV LAP function:

CRISPR-based functional genomics:

  • Host factor identification:

    • Genome-wide CRISPR screens to identify cellular factors required for LAP function

    • Screen design: Express LAP in reporter cell lines (e.g., with MHC-I-GFP fusion) and select for cells resistant to LAP-mediated MHC-I downregulation

    • Secondary screens to determine which identified factors are specifically involved in LAP function versus general ubiquitination pathways

    • This approach could reveal novel components of LAP's mechanism of action

  • Targeted mutagenesis of LAP interaction partners:

    • CRISPR-mediated mutation of specific domains in candidate LAP targets

    • Engineer host cells resistant to LAP effects by modifying substrate interaction sites

    • Test whether these modifications protect against YMTV while maintaining normal cellular function

Viral genome engineering:

  • Scarless recombinant YMTV generation:

    • CRISPR-Cas9-facilitated homologous recombination to create precise LAP mutations

    • Generate a spectrum of LAP variants with single amino acid substitutions

    • Develop LAP-reporter fusion viruses for tracking LAP localization during infection

    • These tools would enable fine mapping of LAP functions in the context of viral infection

  • Orthogonal viral systems:

    • Engineer other poxviruses to express YMTV LAP

    • Determine if LAP confers YMTV-like properties to heterologous viral backgrounds

    • Create chimeric LAP proteins to map domain-specific functions

Synthetic biology approaches:

  • Optogenetic and chemically-inducible LAP systems:

    • Develop light-activated or drug-inducible LAP constructs

    • Enable precise temporal control of LAP expression or activity

    • Monitor immediate cellular responses to LAP activation

    • Example application: Create a split-LAP system where E3 ligase activity can be triggered by light, allowing real-time visualization of substrate ubiquitination

  • Synthetic circuit design:

    • Engineer feedback loops to model LAP's impact on immune signaling networks

    • Create synthetic gene circuits incorporating LAP to study its effects on programmed cellular responses

    • Develop cellular sensors that report on LAP activity through easily measurable outputs

Advanced microscopy applications:

  • CRISPR-based imaging:

    • CRISPR-Cas13-based RNA tracking to visualize LAP mRNA localization during infection

    • dCas9-based DNA labeling to track LAP genomic loci during viral replication

    • These approaches provide insights into the spatiotemporal dynamics of LAP expression

  • Live-cell ubiquitination sensors:

    • Engineer fluorescent ubiquitination biosensors in potential LAP target proteins

    • Monitor ubiquitination in real-time during LAP expression

    • Correlate modification patterns with functional outcomes

Precision animal models:

  • Humanized mouse systems:

    • CRISPR-engineered mice expressing human versions of key LAP targets

    • More accurately model human-specific aspects of LAP function

    • Test species-specific effects observed in primate infections

  • Inducible transgenic systems:

    • Tissue-specific LAP expression in transgenic models

    • Determine LAP effects in isolation from other viral factors

    • Assess contribution to histiocytoma formation independently of viral replication

These cutting-edge approaches would significantly advance our mechanistic understanding of LAP while potentially revealing new therapeutic targets for poxvirus infections and immunomodulatory applications.

What interdisciplinary approaches might yield new insights into the evolutionary significance of YMTV LAP and related viral immune evasion proteins?

Interdisciplinary research combining evolutionary biology, computational modeling, immunology, and systems biology offers promising avenues for understanding the broader significance of YMTV LAP:

Evolutionary and phylogenetic approaches:

  • Comparative genomics:

    • Analyze LAP sequences across the Yatapoxvirus genus and related poxviruses

    • Apply selection pressure analyses to identify rapidly evolving domains

    • Correlate sequence diversity with host range and pathogenesis patterns

    • This is particularly relevant given the detection of YMTV in diverse primates including rhesus monkeys, baboons, and vervet monkeys

  • Host-pathogen co-evolution:

    • Compare LAP across virus isolates from different host species

    • Analyze evolutionary rates relative to host immune factors

    • Reconstruct ancestral LAP sequences to track functional adaptations

    • This approach could reveal host-specific adaptations of LAP function

Structural and biophysical methods:

  • Integrated structural biology:

    • Combine X-ray crystallography, cryo-EM, and NMR approaches

    • Map the interaction surfaces between LAP and host targets

    • Compare binding interfaces with related viral and host E3 ligases

    • Identify structural features that represent evolutionary innovations

  • Molecular dynamics simulations:

    • Model LAP-substrate interactions under different conditions

    • Simulate the impact of evolutionary substitutions on protein function

    • Predict how mutations might alter target specificity or catalytic efficiency

Systems immunology:

  • Network analysis:

    • Map the immune signaling networks perturbed by LAP

    • Compare network effects across different LAP orthologs

    • Identify conserved versus variable network perturbations

    • This would reveal whether different viral E3 ligases converge on critical immune network nodes

  • Mathematical modeling:

    • Develop quantitative models of LAP's impact on antigen presentation

    • Simulate viral fitness under different immune pressures

    • Predict evolutionary trajectories under changing selective forces

Paleovirology and ancient DNA:

  • Endogenous viral element analysis:

    • Search for LAP-like sequences in host genomes

    • Reconstruct ancient viral proteins from endogenized elements

    • Test functionality of reconstructed ancestral proteins

    • This could provide insights into prehistoric host-virus interactions

  • Ancient sample analysis:

    • Examine museum specimens for evidence of historic YMTV infections

    • Sequence viral genomes from preserved tissue samples

    • Track LAP evolution through time in relation to host adaptations

Field and ecological approaches:

  • Wildlife surveillance:

    • Sample potential reservoir species for YMTV-like viruses

    • Analyze LAP sequence diversity in natural populations

    • Correlate viral genotypes with host species and geographic distribution

    • This is particularly important given that the natural reservoir of YMTV remains uncertain

  • One Health integration:

    • Study LAP in the context of primate-human interfaces

    • Assess zoonotic potential of YMTV variants with different LAP sequences

    • Evaluate ecological factors driving LAP evolution

Synthetic evolutionary biology:

  • Directed evolution experiments:

    • Subject LAP to in vitro evolution under defined selective pressures

    • Identify mutations that enhance specific functions

    • Compare laboratory-evolved variants with naturally occurring diversity

  • Ancestral sequence reconstruction:

    • Synthesize predicted ancestral LAP proteins

    • Compare their function with contemporary versions

    • Track functional shifts during evolutionary history

These interdisciplinary approaches would place LAP in a broader evolutionary context while revealing fundamental principles of virus-host interactions that could inform both basic virology and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.