Recombinant Yarrowia lipolytica 3-ketoacyl-CoA reductase (YALI0A06787g)

What is YALI0A06787g and what function does it serve in Yarrowia lipolytica?

YALI0A06787g encodes 3-ketoacyl-CoA reductase (KAR), an essential enzyme in Yarrowia lipolytica's fatty acid elongation system. This enzyme catalyzes the reduction of 3-ketoacyl-CoA intermediates formed during each cycle of fatty acid elongation, specifically in the biosynthesis pathway of very long-chain fatty acids (VLCFAs). It functions as a component of the microsomal membrane-bound fatty acid elongation system that converts palmitate into 26-carbon VLCFAs, which subsequently serve as precursors for ceramide and sphingolipid biosynthesis .

Biochemically, it belongs to the short-chain dehydrogenases/reductases (SDR) family of enzymes . The protein exhibits NADPH-dependent oxidoreductase activity and plays a critical role in lipid metabolism that supports Y. lipolytica's notable capacity for oil accumulation and fatty acid modification.

What expression systems are commonly used for producing recombinant YALI0A06787g?

The most common expression system for recombinant YALI0A06787g is Escherichia coli, which enables high-yield production of the His-tagged protein. According to available product information, the full-length protein (amino acids 1-389) is typically expressed in E. coli with an N-terminal His tag to facilitate purification .

Alternative expression systems include:

When selecting an expression system, researchers should consider the intended application of the recombinant protein, required yield, and whether native conformation or post-translational modifications are essential for functional studies.

How does recombinant YALI0A06787g contribute to metabolic engineering applications in Yarrowia lipolytica?

Recombinant YALI0A06787g plays a significant role in metabolic engineering strategies targeting lipid production pathways in Y. lipolytica. As a key enzyme in the fatty acid elongation process, its controlled expression can modulate the synthesis of very long-chain fatty acids (VLCFAs).

In metabolic engineering contexts, researchers utilize recombinant YALI0A06787g to:

• Enhance production of specialty lipids: By manipulating the expression levels of KAR in conjunction with other fatty acid biosynthesis enzymes, researchers can redirect carbon flux toward the production of specific lipid profiles.

• Produce functional fatty acids: The enzyme's activity influences the chain length of fatty acids, making it a valuable target for engineering strains that produce omega-3 fatty acids such as eicosapentaenoic acid (EPA), which has been successfully commercialized .

• Biodiesel production optimization: KAR plays a role in determining fatty acid composition, which directly impacts biodiesel fuel properties such as cold flow and oxidative stability .

• Carotenoid biosynthesis enhancement: While not directly involved in carotenoid synthesis, KAR's role in lipid metabolism affects the availability of precursors and membrane structures that influence carotenoid production and accumulation .

The effectiveness of these applications depends on balancing KAR expression with other enzymes in relevant pathways to avoid metabolic bottlenecks or imbalances that might trigger stress responses in the host organism .

What are the key challenges in enhancing the catalytic efficiency of recombinant YALI0A06787g for biotechnological applications?

Enhancing the catalytic efficiency of recombinant YALI0A06787g presents several challenges that researchers must address:

• Protein solubility and membrane association: As a component of the membrane-bound fatty acid elongation system, KAR's hydrophobic regions (evident in its sequence: "MVYVNAKNYFCDSIINNTDRVLSALIKYHGLSIIAVFLLAIGLFHVALKVVSYVAVLLDV" ) can complicate expression and purification processes. Researchers must develop strategies to maintain proper folding while achieving sufficient solubility.

• Cofactor dependency: Optimizing the enzyme's interaction with NADPH, its essential cofactor, requires careful consideration of reaction conditions and protein engineering approaches.

• Substrate specificity: Modifying the enzyme to accept different chain length substrates while maintaining catalytic efficiency requires sophisticated protein engineering.

• Integration with metabolic pathways: The enzyme must function effectively within the context of complex lipid biosynthesis pathways, which may require coordinated expression with other enzymes in the elongation system.

• Stability under process conditions: Enhancing thermal and pH stability without compromising activity presents a significant challenge, particularly for industrial applications.

Researchers are addressing these challenges through various approaches, including:

• Directed evolution to identify beneficial mutations

• Structure-guided rational design based on homology models

• Fusion protein strategies to improve solubility

• Optimization of expression conditions and purification protocols

How does the function of YALI0A06787g differ from its homologs in other yeast species?

While YALI0A06787g (3-ketoacyl-CoA reductase) shares functional similarities with homologs in other yeast species, several distinctions are noteworthy:

The differences in these homologs reflect evolutionary adaptations to the specific lipid metabolism needs of each yeast species. Y. lipolytica is naturally oleaginous with enhanced capacity for lipid accumulation and modification, which is reflected in the functional characteristics of its 3-ketoacyl-CoA reductase. These differences make YALI0A06787g particularly valuable for biotechnological applications focused on lipid engineering.

What are the optimal conditions for purifying recombinant YALI0A06787g protein?

Optimal purification of recombinant YALI0A06787g requires careful consideration of its biochemical properties. Based on research protocols, the following conditions are recommended:

• Expression system preparation:

  • E. coli is typically used as the expression host

  • N-terminal His-tagging enables affinity purification

  • Growth conditions should be optimized at 16-25°C after induction to enhance protein folding

• Cell lysis and initial extraction:

  • Buffer composition: Tris-based buffer (pH 8.0) containing mild detergents (0.1% Triton X-100 or n-dodecyl β-D-maltoside)

  • Inclusion of protease inhibitors is essential to prevent degradation

  • Addition of 10% glycerol helps stabilize the protein structure

• Affinity chromatography:

  • Ni-NTA resin binding is performed at 4°C with 20-40 mM imidazole to reduce non-specific binding

  • Washing steps with increasing imidazole concentrations (50-80 mM)

  • Elution with 250-300 mM imidazole

• Final processing:

  • Buffer exchange to remove imidazole using dialysis or gel filtration

  • Final storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Addition of 50% glycerol for long-term storage at -20°C or -80°C

The purified protein typically achieves >90% purity as determined by SDS-PAGE . It's important to avoid repeated freeze-thaw cycles, which can compromise protein activity. Working aliquots can be stored at 4°C for up to one week .

What assays are most reliable for measuring YALI0A06787g enzymatic activity?

Several assay methodologies can be employed to measure the enzymatic activity of recombinant YALI0A06787g (3-ketoacyl-CoA reductase), each with specific advantages:

• Spectrophotometric NADPH consumption assay:

  • Principle: Monitors the decrease in NADPH absorbance at 340 nm as it is consumed during the reduction of 3-ketoacyl-CoA

  • Reaction mix: 3-ketoacyl-CoA substrate (varying chain lengths), NADPH (100-200 μM), buffer (typically 100 mM potassium phosphate, pH 6.8-7.2)

  • Advantages: Real-time kinetic measurements, quantitative data for enzyme kinetics

  • Limitations: Background NADPH oxidation must be controlled for

• High-Performance Liquid Chromatography (HPLC) product formation analysis:

  • Principle: Measures the formation of 3-hydroxyacyl-CoA products

  • Method: Reaction termination at different time points, followed by HPLC separation and detection

  • Advantages: Direct product quantification, specificity for different acyl chain lengths

  • Limitations: Labor-intensive, not real-time

• Coupled enzyme assay:

  • Principle: Links KAR activity to a secondary reaction that generates a more easily detectable signal

  • Components: 3-ketoacyl-CoA, NADPH, coupling enzyme system

  • Advantages: Can enhance sensitivity

  • Limitations: Potential interference from coupling enzymes

For comprehensive characterization, researchers should consider measuring:

• Substrate specificity across different chain lengths (C16-C26)

• Kinetic parameters (Km, Vmax) with varying substrate concentrations

• Cofactor preferences (NADPH vs. NADH)

• Inhibition profiles

• pH and temperature optima

Control experiments should include heat-inactivated enzyme and reactions without substrate to account for background activity.

How can I optimize expression conditions to maximize the yield of functional YALI0A06787g?

Optimizing expression conditions for functional YALI0A06787g requires systematic adjustment of multiple parameters:

• Expression vector selection:

  • Vectors with moderate-strength promoters often yield better results than those with very strong promoters, which can lead to inclusion body formation

  • Consider using pET vectors with T7 lac promoter for inducible expression or tightly regulated arabinose-inducible systems

• Host strain optimization:

  • E. coli BL21(DE3) derivatives are commonly used

  • Strains enhanced for membrane protein expression (C41/C43) or those containing additional chaperones (e.g., BL21-CodonPlus-RP) can improve folding

• Culture conditions optimization:

• Solubility enhancement strategies:

  • Addition of 0.5-2% glycerol to growth media

  • Supplementation with 1% glucose to reduce basal expression before induction

  • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Fusion tags: MBP or SUMO can enhance solubility

• Induction protocol:

  • Consider auto-induction media for gradual protein expression

  • Test both IPTG shock induction and gradual induction protocols

• Extraction and purification optimization:

  • Include appropriate detergents (0.1-0.5% n-dodecyl β-D-maltoside) in lysis buffers

  • Use 10% glycerol in all buffers to stabilize the protein

Experimental validation using activity assays is essential, as conditions that maximize total protein yield may not necessarily maximize functional enzyme. According to product information, properly optimized expression can achieve >90% purity with preserved enzymatic activity .

How should I interpret discrepancies in YALI0A06787g activity between in vitro and in vivo experiments?

Discrepancies between in vitro and in vivo activity of YALI0A06787g are common and can stem from multiple factors:

• Membrane environment differences:

  • In its native context, YALI0A06787g functions within the membrane-bound fatty acid elongation complex

  • In vitro assays often lack the complete membrane environment or associated protein partners

  • Solution: Consider using microsomal preparations or reconstituted membrane systems for more physiologically relevant in vitro assays

• Substrate availability and presentation:

  • In vivo, substrates are presented in specific orientations and concentrations

  • In vitro, artificial substrate concentrations and lack of proper substrate channeling may alter kinetics

  • Solution: Titrate substrate concentrations carefully and consider coupled enzyme systems that more closely mimic the natural pathway

• Cofactor regeneration:

  • In vivo, NADPH regeneration systems maintain optimal cofactor levels

  • In vitro, NADPH is often provided at fixed concentrations without regeneration

  • Solution: Implement NADPH regeneration systems (e.g., glucose-6-phosphate dehydrogenase) in in vitro assays

• Post-translational modifications:

  • The recombinant protein expressed in E. coli lacks eukaryotic post-translational modifications

  • Solution: Consider expression in eukaryotic systems for studies where post-translational modifications may be critical

• Data interpretation framework:

  • In vitro data provides mechanistic insights and kinetic parameters

  • In vivo data captures physiological relevance and pathway integration

  • Solution: Use both approaches complementarily rather than expecting perfect correlation

When faced with discrepancies, document the exact conditions of both systems and systematically vary parameters to identify the source of differences. This process itself often yields valuable insights into the enzyme's regulatory mechanisms and contextual requirements.

What are the common pitfalls in studying YALI0A06787g function and how can they be avoided?

Research on YALI0A06787g presents several common pitfalls that can be mitigated through careful experimental design:

• Protein instability and aggregation:

  • Pitfall: The membrane-associated nature of the protein can lead to aggregation during purification

  • Solution: Maintain 10% glycerol in all buffers, avoid detergent concentrations above critical micelle concentration, and include 6% trehalose in storage buffers

• Loss of activity during storage:

  • Pitfall: Repeated freeze-thaw cycles significantly reduce enzyme activity

  • Solution: Store working aliquots at 4°C for up to one week and maintain long-term stocks at -80°C with 50% glycerol

• Substrate limitations:

  • Pitfall: Commercial 3-ketoacyl-CoA substrates are expensive and limited in chain-length variety

  • Solution: Consider enzymatic synthesis of substrates or use surrogate substrates with validation experiments

• Incomplete pathway reconstitution:

  • Pitfall: Studying KAR in isolation misses important interactions with other components of the elongation system

  • Solution: Consider co-expression with partner proteins or use of partial pathway reconstitution

• Expression system artifacts:

  • Pitfall: Expression in E. coli can result in protein with different properties than the native enzyme

  • Solution: Validate key findings in Y. lipolytica systems when possible

• Overlooking strain-specific variations:

  • Pitfall: Assuming all Y. lipolytica strains have identical KAR properties

  • Solution: Sequence verification and careful strain documentation

• Assay interference:

  • Pitfall: Components in crude extracts can interfere with activity measurements

  • Solution: Include appropriate controls and consider multiple assay methods for confirmation

• Data misinterpretation:

  • Pitfall: Attributing observed effects solely to KAR when multiple pathway steps may be affected

  • Solution: Use specific inhibitors, genetic knockouts, or complementation studies to confirm causality

By anticipating these challenges, researchers can design more robust experiments that yield reliable and reproducible results for YALI0A06787g functional studies.

How do environmental stress conditions affect YALI0A06787g expression and function in Yarrowia lipolytica?

Environmental stress significantly impacts YALI0A06787g expression and function, an important consideration for both fundamental research and biotechnological applications:

• Temperature stress effects:

  • Cold stress typically upregulates fatty acid desaturases while modulating elongases and reductases like YALI0A06787g to maintain membrane fluidity

  • Heat stress can trigger protective lipid modifications, affecting the demand for KAR activity

  • These responses are part of Y. lipolytica's "fight-flight-or-freeze" stress adaptation mechanism

• Nutrient limitation impacts:

  • Nitrogen limitation generally enhances lipid accumulation pathways, increasing demand for fatty acid modification enzymes

  • Carbon source variations alter flux through lipid metabolism pathways, affecting KAR substrate availability

• Oxidative stress considerations:

  • Oxidative conditions can directly damage the enzyme's structure and function

  • Y. lipolytica often responds by adjusting membrane composition through altered fatty acid metabolism

• pH tolerance:

  • Y. lipolytica demonstrates remarkable pH tolerance, maintaining functional lipid metabolism across a wide pH range

  • This adaptation involves coordinated regulation of membrane-associated enzymes including KAR

• Stress response integration:

  • Environmental stressors trigger complex transcriptional cascades that modulate YALI0A06787g expression

  • These responses must be considered when designing experiments or production processes

For researchers working with recombinant YALI0A06787g, understanding these stress responses provides opportunities for process optimization. For example, controlled exposure to specific stressors can be used to enhance expression or modulate activity in desired directions. Additionally, stress-adapted variants of the enzyme may offer improved stability or functionality in biotechnological applications .

When designing experiments, researchers should carefully control environmental parameters and consider how stress conditions might influence their results, particularly in experiments comparing wild-type and engineered strains.

How are recent advances in protein engineering being applied to enhance YALI0A06787g functionality?

Protein engineering approaches are increasingly being applied to enhance YALI0A06787g functionality for both research and biotechnological applications:

• Rational design strategies:

  • Structure-guided mutations targeting the active site to alter substrate specificity

  • Engineering cofactor binding sites to improve NADPH utilization efficiency

  • Modifying membrane interaction domains to enhance stability while maintaining function

• Directed evolution approaches:

  • Error-prone PCR libraries screened for variants with enhanced thermostability

  • DNA shuffling with homologs from extremophilic yeasts to generate chimeric enzymes with superior properties

  • Selection systems linking KAR activity to growth under specific conditions

• Computational design methods:

  • Molecular dynamics simulations to identify flexible regions that could be stabilized

  • In silico substrate docking to predict mutations that might alter chain length specificity

  • Machine learning approaches integrating multiple protein properties to guide engineering efforts

• Fusion protein strategies:

  • Creation of multi-enzyme complexes to enhance substrate channeling

  • Addition of solubility-enhancing domains while preserving catalytic activity

  • Membrane-targeting motifs to ensure proper localization in heterologous systems

The application of these advanced techniques is shifting from simple expression optimization toward the creation of custom-designed variants with properties tailored for specific applications in biofuel production, specialty lipid synthesis, and other biotechnological processes.

What role does YALI0A06787g play in the metabolic stress response of Yarrowia lipolytica?

YALI0A06787g plays a multifaceted role in Y. lipolytica's metabolic stress response, particularly in conditions that affect lipid metabolism:

• Membrane integrity maintenance:

  • During environmental stress, YALI0A06787g contributes to membrane remodeling via its role in very long-chain fatty acid synthesis

  • This process is critical for adapting membrane fluidity and permeability to changing conditions

• Metabolic flux redirection:

  • Under nutrient limitation, activity of this enzyme supports the redirection of carbon flux toward storage lipids

  • This represents part of Y. lipolytica's "fight-flight-or-freeze" stress adaptation strategy

• Recombinant protein stress interactions:

  • When Y. lipolytica is engineered to overproduce recombinant secretory proteins, endoplasmic reticulum stress can trigger changes in lipid metabolism pathways

  • YALI0A06787g activity is modulated as part of the unfolded protein response, affecting membrane composition of the secretory pathway

• Adaptation to carbon source variations:

  • Different carbon sources alter the expression and activity profile of YALI0A06787g

  • This adaptation mechanism helps optimize membrane composition for specific growth conditions

• Oxidative stress defense:

  • Altered lipid profiles can provide protection against oxidative damage

  • YALI0A06787g participates in these adaptive changes through its role in VLCFA synthesis

Understanding these stress response connections is valuable for metabolic engineering applications, as it allows researchers to anticipate and mitigate potential negative effects of genetic modifications on cell physiology. Additionally, controlled induction of specific stress responses can be harnessed to enhance desired metabolic activities in biotechnological applications.

How does YALI0A06787g expression compare across different growth phases and nutrient conditions in Yarrowia lipolytica?

YALI0A06787g expression exhibits dynamic patterns across growth phases and nutrient conditions, reflecting Y. lipolytica's metabolic adaptability:

• Growth phase-dependent expression:

  • Exponential phase: Moderate expression levels supporting active membrane synthesis

  • Late exponential/early stationary phase: Upregulation coinciding with increased lipid accumulation

  • Stationary phase: Sustained expression to maintain membrane integrity during nutrient limitation

• Carbon source effects:

  • Glucose: Baseline expression levels

  • Oleic acid and other lipids: Enhanced expression to support fatty acid modification

  • Alkanes: Significant upregulation, reflecting the role of VLCFAs in adaptation to hydrophobic substrates

• Nitrogen limitation response:

  • Nitrogen depletion typically triggers lipid accumulation in Y. lipolytica

  • YALI0A06787g expression is modulated as part of this response to support the synthesis of modified fatty acids

• Phosphate limitation effects:

  • Phosphate limitation often leads to membrane lipid remodeling

  • YALI0A06787g activity increases to support these changes

• Oxygen availability influence:

  • Hypoxic conditions alter fatty acid metabolism

  • YALI0A06787g expression adjusts to support necessary membrane modifications under oxygen limitation

These expression patterns have important implications for experimental design and bioprocess optimization. Researchers should carefully consider growth phase and nutrient status when:

• Harvesting cells for enzyme purification

• Measuring enzyme activity in whole cells or extracts

• Designing feeding strategies for bioreactor cultivation

• Interpreting transcriptomic or proteomic data

Understanding these dynamic expression patterns can help researchers optimize conditions for both fundamental studies and biotechnological applications utilizing YALI0A06787g.