Recombinant Yarrowia lipolytica 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Shipped with Ice Packs
In Stock

Description

Introduction

Yarrowia lipolytica is a non-conventional yeast that has garnered significant attention in industrial biotechnology due to its ability to produce various valuable compounds, including organic acids, lipids, and proteins . Y. lipolytica's advanced secretory pathway and high protein secretion capacity make it a favorable host for the production of complex enzymes and biopharmaceuticals .

Definition of TSC10

TSC10, or 3-ketodihydrosphingosine reductase, is an enzyme that catalyzes the reduction of 3'-oxosphinganine (also known as 3-ketodihydrosphingosine or KDS) to sphinganine (dihydrosphingosine or DHS) . This enzymatic reaction represents the second step in the de novo synthesis of sphingolipids .

Role and Function

The primary function of TSC10 is to facilitate the production of sphinganine, a crucial precursor in sphingolipid biosynthesis . Sphingolipids are essential components of eukaryotic cell membranes, playing roles in cell signaling, membrane structure, and various cellular processes .

Biotechnological Applications of Yarrowia lipolytica

Yarrowia lipolytica has been engineered to produce a wide array of terpenoids, which have applications as advanced fuels, chemicals, pharmaceutical ingredients, and agricultural chemicals . Genetic modifications, such as the overexpression of HMG-CoA reductase (HMG), have been employed to enhance the production of various terpenoids in Y. lipolytica .

Terpenoid Production in Engineered Yarrowia lipolytica Strains

TerpenoidProduction (mg/L)
Limonene35.9
Valencene113.9
Squalene402.4
2,3-Oxidosqualene22
β-Carotene164

Improving Protein Secretion in Yarrowia lipolytica

Several strategies can improve protein secretion in Y. lipolytica, including codon optimization, increasing gene copy number, using inducible expression systems, and engineering secretory tags . Engineering the native lip2prepro secretion signal has improved secreted protein titers .

Proteolytic Activity of Yarrowia lipolytica

Yarrowia lipolytica produces alkaline, neutral, or acidic proteolytic enzymes . The yeast strain Y. lipolytica IPS21 exhibits proteolytic activity, particularly in the presence of waste carbon sources like chrome-tanned leather shavings (CTLS) .

Impact on Lipid Metabolism

Extracts from yarrow (Achillea millefolium L.) can inhibit lipid metabolism in colorectal cancer cells . Specific bioactive compounds found in yarrow can target key lipid metabolic pathways, affecting genes such as SREBF1, FASN, ABCA1, and HMGCR .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TSC10; YALI0B17688g; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
TSC10
Target Protein Sequence
MIFPISEIPDKVTHSILEGVSALQNMSHTAFWSTVLGFLVVARIAVILATPKRRVLDIKG KKVVISGGSQGAGAALAELCYTKGANVVIVSRTVSKLEAQVQKIVTKHEPVFEGQTIRYI SADLTKEEEAIRVFSEETMPAPPDVIFSCAGAAETGFILDFKASQLARAFSTNYLSALFF VHAGTTRMAKEPISPKNPRYVAIFSSVLAFYPLLGYGQYCASKAAVRSLIDSLRVEALPF NIRVVGVFPGNFQSEGFEEENKSKPEITRQIEGPSQAISAEECAKIVFAQMEKGGQMITT DLIGWILQSIALSSSPRSFSLLQIPLAIFMCIFSPVWNAFVNRDVRKYFHANTEYVTRHQ RGGVGSENPTPQ
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is 3-ketodihydrosphingosine reductase and its role in sphingolipid metabolism?

3-ketodihydrosphingosine reductase (EC 1.1.1.102), also known as KDSR or TSC10, catalyzes the reduction of 3-dehydrosphinganine to sphinganine using NADPH as a cofactor. This enzyme belongs to the oxidoreductase family, specifically acting on the CH-OH group of donors with NADP+ as an acceptor. The reaction follows this stoichiometry:

3-dehydrosphinganine + NADPH + H+ → sphinganine + NADP+

This represents a critical step in sphingolipid biosynthesis, where failure of this enzymatic reaction can lead to pathogenesis with elevated long chain base (LCB)-derived biomarkers .

Why is Yarrowia lipolytica advantageous for recombinant TSC10 expression?

Yarrowia lipolytica presents several advantages for recombinant TSC10 expression:

  • As an oleaginous yeast, it efficiently maintains lipid metabolism pathways relevant to sphingolipid synthesis

  • It has sophisticated genetic tool development including integrative multi-copy expression vectors

  • It can utilize various carbon sources, enhancing cultivation flexibility

  • It has been successfully used for heterologous protein expression in numerous studies

  • GRAS (Generally Recognized As Safe) status permits broader application scopes

These yeast cells can handle significant metabolic load during recombinant protein production and maintain balanced growth with protein synthesis, particularly when expression strategies are optimized .

How does the sphingolipid biosynthesis pathway differ between Y. lipolytica and other organisms?

Like other fungi, Y. lipolytica produces sphingolipids containing phytosphingosine due to the action of C4-hydroxylase, which hydroxylates the C4 position of the LCB, whereas mammals typically have sphingosine-based sphingolipids, except in tissues like skin where DEGS2 provides C4-hydroxylase activity .

What expression vectors are most effective for TSC10 expression in Y. lipolytica?

For effective TSC10 expression in Y. lipolytica, researchers typically utilize integrative multi-copy expression vectors containing:

  • Strong promoters:

    • Constitutive promoters like pTEF or hp4d for continuous expression

    • Inducible promoters like pICL1 (isocitrate lyase promoter) for controlled expression during specific growth phases

  • Effective selection markers:

    • ura3d4 as a multi-copy selection marker enabling selection of transformants with multiple integrated expression cassettes

  • Targeted integration sequences:

    • rDNA sequences for site-specific multiple integrations

    • Long terminal repeat (LTR) zeta sequences of Ylt1 retrotransposon, which exist in multiple copies in some Y. lipolytica strains

The approach demonstrated by researchers shows integration of up to three expression vectors containing different heterologous cDNAs via simultaneous transformation, with subsequent diploidization techniques allowing development of strains with three to five different expression cassettes .

How can researchers optimize copy number for maximum TSC10 expression?

Optimizing copy number for maximum TSC10 expression requires:

  • Selection of appropriate vectors:

    • Using defective marker (ura3d4) selection strategy that favors multi-copy integration

    • Targeting integration to repetitive genomic sequences like rDNA or zeta elements

  • Copy number verification:

    • Southern blotting to confirm integration and estimate copy number

    • qPCR to quantify gene copy number precisely

  • Stability considerations:

    • Testing copy number stability during prolonged cultivation

    • Monitoring for potential homologous recombination leading to cassette loss

Research has shown that enhanced ability to metabolize available carbon sources can be achieved with higher copy number, but there is not always a linear relationship between copy number and expression levels due to metabolic load constraints. For recombinant enzyme production, an optimum copy number often exists where expression is maximized before metabolic burden becomes detrimental .

What experimental design approaches are most appropriate for studying recombinant TSC10 function?

To effectively study recombinant TSC10 function, consider these experimental design approaches:

  • Factorial design:

    • Allows manipulation of multiple independent variables (treatments)

    • Enables examination of both individual effects (main effects) and joint effects (interaction effects)

    • For example, testing the effects of carbon source, nitrogen source, pH, and temperature on TSC10 expression and activity

  • Randomized block design:

    • Useful when the subject population can be grouped into homogeneous subgroups

    • Reduces "noise" or variance in data attributable to differences between blocks

    • For instance, testing different Y. lipolytica strains expressing TSC10 under the same conditions

  • Between-subjects or within-subjects designs:

    • Between-subjects: Different strains/conditions are tested with different samples

    • Within-subjects: Same strain tested under multiple conditions

Each experimental cell should have a minimum sample size of 20 for statistical power. Proper control groups are essential for valid comparisons .

What cultivation strategies maximize recombinant TSC10 production?

For maximizing recombinant TSC10 production, consider these cultivation strategies:

  • Media optimization:

    • Carbon source: Glycerol has shown advantages for recombinant protein expression in Y. lipolytica, with strains containing GUT1 (glycerol kinase) overexpression showing higher substrate utilization rates

    • Nitrogen source: Complex nitrogen sources like peptone and yeast extract can enhance protein production

    • Supplementation: Addition of specific amino acids can improve protein folding and stability

  • Process strategies:

    • Batch cultivation: Simple but limited by nutrient availability and waste accumulation

    • Fed-batch: Allows control of growth rate and extends production phase

    • Chemostat cultivation: Enables steady-state conditions for studying specific physiological states

  • Growth parameters:

    • Growth rate: A specific growth rate of 0.1 h-1 has been commonly used for recombinant protein production in Y. lipolytica, balancing growth and protein synthesis

    • pH control: Important for protein stability and activity

    • Temperature: Typically 28-30°C for Y. lipolytica

  • Induction strategies (when using inducible promoters):

    • Timing of induction: Typically after reaching sufficient biomass

    • Inducer concentration: May affect expression level in a dose-dependent manner

Proper aeration and mixing are crucial for high-density cultivation and protein production .

What analytical methods effectively measure TSC10 activity in Y. lipolytica?

To measure TSC10 activity in Y. lipolytica effectively:

  • Enzyme activity assays:

    • Spectrophotometric NADPH consumption/formation monitoring at 340 nm

    • Radiometric assays using radiolabeled substrates

    • Coupled enzyme assays that link TSC10 activity to a detectable output

  • Protein detection methods:

    • Western blotting with specific antibodies (if available)

    • Fusion tags (His, FLAG, etc.) for detection and purification

    • Mass spectrometry for protein identification and quantification

  • Substrate/product analysis:

    • NPLC-Corona-CAD® for time-dependent analysis of lipid species

    • NPLC-APPI+-HRMS for determining fatty acyl composition of glycero- and glycerophospholipids

    • GC-MS analysis of derivatized sphingolipids

These analytical approaches provide complementary information about enzyme expression, activity, and impact on cellular metabolism .

How does TSC10 overexpression affect the lipid profile and metabolism of Y. lipolytica?

TSC10 overexpression in Y. lipolytica likely causes significant metabolic readjustments in sphingolipid metabolism:

  • Sphingolipid composition changes:

    • Increased dihydrosphingosine levels due to enhanced conversion of 3-ketodihydrosphingosine

    • Potential alterations in downstream sphingolipid species including ceramides, sphingomyelins, and complex sphingolipids

    • Possible accumulation of free fatty acids and diglycerides as observed in other lipid pathway modifications

  • Membrane composition effects:

    • Altered phospholipid profiles, particularly phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylinositol

    • Changes in cardiolipin (CL) composition, which may affect mitochondrial function

    • Time-dependent changes in lipid profiles as observed in other lipid metabolic engineering studies

  • Metabolic flux redirections:

    • Potential competition for NADPH with other biosynthetic pathways

    • Altered carbon flow through central carbon metabolism

    • Changes in gene expression patterns for compensatory metabolic adjustments

Research examining other lipid pathway modifications in Y. lipolytica has shown that overproduction of specific lipid species can lead to complex metabolic readjustments, suggesting similar effects would occur with TSC10 overexpression .

How can isotope labeling and metabolic flux analysis be applied to study TSC10 function?

Isotope labeling and metabolic flux analysis provide powerful approaches to study TSC10 function:

  • 13C-isotope tracing methodology:

    • Culture cells with 13C-labeled substrates (e.g., 13C-glucose, 13C-glycerol, or 13C-fatty acids)

    • Harvest biomass during exponential growth phase

    • Extract and analyze labeled metabolites using GC-MS or LC-MS

    • For protein-derived amino acids, use TBDMS (N-(tert-butyldimethylsilyl)-N-methyltrifluoroacetamide) derivatization for GC-MS analysis

  • Experimental design options:

    • Single labeled substrate experiments (fully 13C-labeled substrate)

    • Parallel labeling experiments (one 13C-labeled and one unlabeled substrate)

    • Dynamic labeling experiments (time-course sampling after label introduction)

  • Data analysis approaches:

    • Isotopomer distribution analysis to determine metabolic pathway contributions

    • Metabolic flux calculation using stoichiometric models

    • Comparison of flux distributions between wild-type and TSC10-overexpressing strains

  • Application to sphingolipid metabolism:

    • Tracing carbon flow from glucose or glycerol to serine and palmitoyl-CoA (TSC10 substrates)

    • Quantifying flux through the sphingolipid biosynthesis pathway

    • Identifying potential metabolic bottlenecks or regulatory points

This approach has been successfully used to study lipid metabolism in Y. lipolytica, revealing segregated metabolic networks during co-catabolism of sugars and fatty acid substrates .

What challenges exist in scaling up TSC10 production in Y. lipolytica bioreactors?

Scaling up TSC10 production in Y. lipolytica bioreactors presents several challenges:

  • Bioreactor scale considerations:

    • Small-scale: Systems like DASbox® mini bioreactor (60-250 mL working volume) useful for initial optimization

    • Pilot scale: Moving to larger volumes (>500 L) introduces heterogeneity challenges in the culture broth

    • Physical parameters: Changes in mixing, mass transfer, and heat transfer require recalibration

  • Process optimization challenges:

    • Maintaining dissolved oxygen levels becomes more difficult at larger scales

    • Heat removal can become limiting during high-density cultivation

    • Nutrient gradients may form, creating microenvironments with different conditions

  • Expression stability concerns:

    • Copy number instability over prolonged cultivation periods

    • Selective pressure for reduced metabolic burden may lead to mutations

    • Consistency of post-translational modifications at different scales

  • Analytical and process control needs:

    • Online monitoring systems for key parameters

    • Feed control strategies for fed-batch operation

    • Development of predictive models for process behavior

Research has shown that while scaling presents challenges, Y. lipolytica has been successfully cultivated at pilot scale (500 L) for recombinant protein production, suggesting TSC10 production should be feasible with appropriate process development .

How does TSC10 expression in Y. lipolytica compare with other expression systems?

Expression SystemAdvantages for TSC10 ExpressionLimitationsExpression Yield Potential
Y. lipolytica- Natural lipid metabolism capability
- Growth on various carbon sources
- Post-translational modifications
- Multi-copy integration possible
- Less genetic tools than S. cerevisiae
- More complex media requirements
- Longer development time
High (especially with lipid substrates)
S. cerevisiae- Well-established genetic tools
- Extensive knowledge on cultivation
- Simple media requirements
- Less efficient lipid metabolism
- Lower secretion capacity
- Different sphingolipid metabolism
Moderate
E. coli- Rapid growth
- Simple cultivation
- Well-established genetic tools
- No post-translational modifications
- Inclusion body formation risk
- No native sphingolipid pathway
Low to moderate
Mammalian cells- Native environment for mammalian TSC10
- Correct folding and modifications
- Integrated with natural regulatory mechanisms
- Slow growth
- Complex media
- Expensive cultivation
- Low yields
Low

The choice of expression system depends on research goals. Y. lipolytica offers unique advantages for studying TSC10 in a eukaryotic system with active sphingolipid metabolism, while maintaining reasonable yields and authentic post-translational modifications .

How can genomic integration approaches for TSC10 be optimized in Y. lipolytica?

Optimizing genomic integration of TSC10 in Y. lipolytica:

  • Integration targeting strategies:

    • rDNA targeting: Using rDNA sequences as integration targeting sequences allows multiple integrations at the numerous rDNA loci

    • Zeta element targeting: The long terminal repeat (LTR) zeta of Ylt1 retrotransposon serves as integration targeting sequences in strains containing these elements

    • Random integration: Non-targeted integration can sometimes achieve high copy numbers but with less predictability

  • Multi-copy integration approaches:

    • Defective selection marker strategy: Using ura3d4 as a multi-copy selection marker favors transformants with multiple integrated copies

    • Sequential transformation: Multiple transformation rounds can increase copy number

    • Diploidization approach: Combining different expression cassettes through diploidization of haploid transformants

  • Verification methods:

    • Southern blotting for integration confirmation

    • qPCR for copy number determination

    • Expression analysis via RT-qPCR and Western blotting

  • Stability considerations:

    • Long-term cultivation studies to assess stability

    • Selection pressure maintenance during production

Research has demonstrated successful integration of up to three expression vectors simultaneously, with subsequent diploidization allowing strains with three to five expression cassettes. This approach is particularly useful for multi-component enzyme systems .

What statistical approaches are appropriate for analyzing enzyme kinetics data from recombinant TSC10?

For analyzing enzyme kinetics data from recombinant TSC10:

  • Non-linear regression analysis:

    • Michaelis-Menten kinetics: Determine Km and Vmax parameters

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for alternative visualizations

    • Enzyme inhibition models (competitive, non-competitive, uncompetitive) when testing inhibitors

  • Comparative statistical tests:

    • ANOVA for comparing multiple experimental conditions

    • Student's t-test for comparing two conditions

    • Multiple comparison corrections (e.g., Bonferroni, Tukey) when testing multiple hypotheses

  • Experimental design considerations:

    • Minimum of three technical replicates per data point

    • Biological replicates from independent transformations

    • Appropriate controls (untransformed strain, empty vector controls)

  • Data validation approaches:

    • Residual analysis to check model fit

    • Bootstrapping for parameter confidence intervals

    • Sensitivity analysis for model parameters

These statistical approaches ensure robust interpretation of enzyme kinetics data, allowing valid comparisons between different experimental conditions and accurate determination of kinetic parameters .

How can metabolic pathway modeling incorporate TSC10 activity in Y. lipolytica?

Incorporating TSC10 activity into metabolic pathway models for Y. lipolytica:

  • Stoichiometric modeling approaches:

    • Genome-scale metabolic models (GEMs) incorporating sphingolipid metabolism

    • Flux balance analysis (FBA) to predict metabolic fluxes with varying TSC10 activity

    • Metabolic control analysis (MCA) to determine flux control coefficients for TSC10

  • Kinetic modeling elements:

    • Incorporation of experimentally determined kinetic parameters (Km, Vmax, kcat)

    • Integration of regulatory mechanisms affecting TSC10 expression and activity

    • Dynamic simulation of metabolite concentrations over time

  • Multi-omics data integration:

    • Transcriptomics data to inform gene expression constraints

    • Proteomics data for enzyme abundance estimates

    • Metabolomics data for validation of predicted metabolite levels

  • Validation approaches:

    • 13C metabolic flux analysis data for flux distribution validation

    • Comparison of growth predictions with experimental measurements

    • Testing model predictions with genetic perturbations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.