Recombinant Yarrowia lipolytica Alpha-1,3/1,6-mannosyltransferase ALG2 (ALG2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for prioritized development.
Synonyms
ALG2; YALI0E31797g; Alpha-1,3/1,6-mannosyltransferase ALG2; Asparagine-linked glycosylation protein 2; GDP-Man:Man(1GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1GlcNAc(2-PP-dolichol mannosyltransferase; GDP-Man:Man(2GlcNAc(2-PP-Dol alpha-1,6-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
ALG2
Target Protein Sequence
MRVAFIHPDLGIGGAERWVVDAAVGLQNLGHEVDIYTSYCNKSHCFDEVRDGLLKVTVLG DTICPHTIKGKFAIFCATFRQLHLAYELKKGPGSKVDVFVVDQLSACVPLLKLWFPKARV LFYGHFPDQLLVQNRNQMSLVKKAYRYPFDKFEEITTASADRLVVNSHFTKDMFEKTFPA TKNPLVIYPCVDTDIKEQQQGLDRDMITAASQYTFLLSINRFERKKNILLAIEAFGEAQK KSSNLKLAVAGGYDFRVNENVEYLQELILACEKLKLSHISITADKYAKLLEKDTPAAVWT SIFKNDVIFFPSASNSFKNTLLHISKLLLYTPQNEHFGIVPLEGMLWKTPVLATNSGGPL ETVKDNVGWTVEGKSELWAPVIDKVVHMNASDYAVLQTECVNWVNRFSQDTMASELEEAM EEVRKKAPTENVGWDYIRLGMWYSVLMTLTLSIVLLAIWP
Uniprot No.

Target Background

Function

Function: Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.

Database Links
Protein Families
Glycosyltransferase group 1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the role of ALG2 in Yarrowia lipolytica glycosylation pathways?

ALG2 is a key glycosyltransferase that functions in the early steps of N-linked glycosylation in Yarrowia lipolytica. Specifically, ALG2 adds both an α1,3-linked and an α1,6-linked mannose to the growing lipid-linked oligosaccharide (LLO) structure on the cytoplasmic side of the endoplasmic reticulum (ER). This enzyme acts after the first mannose is added by Alg1, creating the Man3GlcNAc2 structure, which is a critical intermediate in the N-glycosylation pathway . This structure serves as the foundation for further elaboration of the oligosaccharide before it is flipped into the ER lumen, where additional modifications occur in the maturation of N-glycans.

How does Y. lipolytica ALG2 compare with homologous enzymes in other yeasts?

Y. lipolytica ALG2, like its homolog in Saccharomyces cerevisiae, catalyzes the addition of both α1,3-linked and α1,6-linked mannose residues during early N-glycan assembly. While the core function appears conserved across yeast species, Y. lipolytica exhibits some distinct glycosylation patterns compared to S. cerevisiae. The study of alpha-1,6-mannosyltransferases in Y. lipolytica, such as YlAnl1p and YlOch1p, has revealed that disruption of these genes causes increased sensitivity to SDS (indicating glycosylation defects) and to Calcofluor White (characteristic of cell-wall defects) . This suggests that mannosyltransferases, including ALG2, play critical roles in maintaining proper cell wall structure and function in Y. lipolytica.

What are the most effective methods for cloning and expressing recombinant Y. lipolytica ALG2?

For successful cloning and expression of recombinant Y. lipolytica ALG2, researchers should consider the following methodological approach:

  • Vector Selection: Integrative multi-copy expression vectors containing the ALG2 cDNA under the control of the isocitrate lyase promoter (pICL1) are recommended. These can be constructed using basic plasmids like p64PT or p67PT, which utilize rDNA or the long terminal repeat (LTR) zeta of Ylt1 as integration targeting sequences and ura3d4 as a multi-copy selection marker .

  • Transformation Strategy: A two-step approach for constructing recombinant strains allows for simple introduction of several expression cassettes into the yeast genome. This involves:

    • Initial transformation into haploid recipient strains with simultaneous integration of up to three expression vectors containing different heterologous cDNAs

    • Subsequent diploidization using selected haploid multi-copy transformants to obtain further combinations of different expression cassettes

  • Verification Methods: Successful integration and expression should be verified through:

    • Southern blotting to confirm the presence of the expression cassettes

    • Western blotting to identify protein expression

This methodology has been proven effective for the heterologous expression of multi-component enzyme systems in Y. lipolytica and can be adapted specifically for ALG2 expression.

What reference genes should be used when conducting gene expression studies involving Y. lipolytica ALG2?

When conducting gene expression studies involving Y. lipolytica ALG2, selection of appropriate reference genes is critical for accurate normalization of RT-qPCR data. Based on comprehensive stability assessments of multiple genes across varying conditions, the following recommendations can be made:

Using appropriate reference genes will ensure more reliable quantification of ALG2 expression levels and more accurate comparisons between experimental conditions.

How does disruption of ALG2 in Y. lipolytica affect the N-glycosylation pathway and cellular phenotype?

Disruption of ALG2 in Y. lipolytica would significantly impair the early steps of N-glycosylation, as this enzyme is responsible for adding both α1,3-linked and α1,6-linked mannose residues to form the Man3GlcNAc2 structure. Based on studies of related mannosyltransferases in Y. lipolytica, ALG2 disruption would likely result in:

  • Incomplete LLO synthesis: The LLO biosynthesis would be arrested at the GlcNAc2Man1 stage, preventing the formation of the complete oligosaccharide structure required for proper N-glycosylation .

  • Hypoglycosylation phenotype: Similar to disruptions of other genes in the N-glycosylation pathway (YlMNN9, YlANL1, YlOCH1), an ALG2 disruption would likely cause increased sensitivity to compounds like SDS, indicating defects in glycosylation .

  • Cell wall integrity issues: Based on observations with other mannosyltransferase disruptions, ALG2-disrupted strains would likely show increased sensitivity to Calcofluor White, reflecting defects in cell wall structure and integrity .

  • Impaired protein secretion: Improper N-glycosylation would affect protein folding, quality control, and secretion, potentially leading to ER stress and activation of the unfolded protein response .

These phenotypes can be assessed through sensitivity assays, Western blotting of glycoproteins to detect altered glycosylation patterns, and microscopic examination of cell morphology.

Can complementation with S. cerevisiae ALG2 rescue Y. lipolytica ALG2 mutants, and what does this reveal about functional conservation?

While the search results don't directly address complementation experiments with ALG2, insights can be drawn from similar studies with other glycosylation genes in Y. lipolytica. In a complementation approach:

  • Experimental design would involve:

    • Creation of a Y. lipolytica ALG2 knockout strain

    • Introduction of the S. cerevisiae ALG2 gene under the control of a suitable Y. lipolytica promoter

    • Assessment of N-glycosylation restoration through phenotypic assays and glycoprotein analysis

  • Expected outcomes:

    • Full complementation would suggest complete functional conservation

    • Partial complementation would indicate some divergence in enzyme properties or interactions

    • No complementation would suggest significant evolutionary divergence or different cellular requirements

  • Analytical methods:

    • Western blotting of model glycoproteins to assess glycosylation patterns

    • SDS and Calcofluor White sensitivity assays to evaluate cell wall integrity

    • Growth rate measurements under various conditions

    • Mass spectrometry analysis of N-glycan structures

Such complementation studies would provide valuable insights into the evolutionary conservation of ALG2 function and could reveal species-specific adaptations in the N-glycosylation machinery.

What are the critical catalytic domains and residues in Y. lipolytica ALG2 that determine substrate specificity?

The ALG2 enzyme in Y. lipolytica, like other glycosyltransferases, contains specific domains and residues that are critical for its dual α1,3/1,6-mannosyltransferase activity. While the exact structure of Y. lipolytica ALG2 is not detailed in the search results, the following can be inferred from studies of homologous enzymes:

  • Catalytic domains:

    • A nucleotide-binding domain that interacts with the GDP-mannose donor

    • A catalytic core containing DXD motifs typical of glycosyltransferases, which coordinate divalent cations necessary for catalysis

    • Substrate binding regions that recognize the GlcNAc2Man1 acceptor structure

  • Functional analysis approach:

    • Site-directed mutagenesis targeting conserved residues

    • Activity assays measuring transfer of mannose to appropriate acceptor substrates

    • Structural modeling based on homologous enzymes with known structures

    • Analysis of substrate binding through biochemical approaches

  • Experimental validation:

    • In vitro assays with purified recombinant enzyme and defined substrates

    • Complementation studies with specific point mutations to correlate structure with function

    • Analysis of N-glycan structures produced by mutant enzymes using mass spectrometry

Understanding these structure-function relationships is crucial for engineering ALG2 enzymes with modified activities for glycoengineering applications.

How can recombinant Y. lipolytica ALG2 be utilized in glycoengineering strategies for humanized glycoprotein production?

Recombinant Y. lipolytica ALG2 plays a critical role in glycoengineering strategies aimed at humanizing yeast-produced glycoproteins. The following approaches can be implemented:

  • Controlled expression of ALG2:

    • Modulating ALG2 expression levels can influence the early steps of N-glycan synthesis

    • Integration of ALG2 expression cassettes using multi-copy vectors with appropriate promoters like pICL1 allows for fine-tuned expression

  • Combined genetic modifications:

    • ALG2 manipulation can be paired with other glycoengineering strategies, such as:

      • Expression of ER-localized α1,2-mannosidases to trim mannose residues

      • Deletion of genes like ALG3 (which initiates the B- and C-branches of LLO) to generate less complex N-glycans

      • Introduction of human-type glycosyltransferases such as GnTI and GnTII

  • Creating humanized glycosylation pathways:

    • A comprehensive approach involving:

      • Control of early N-glycan assembly through ALG2 and related enzymes

      • Trimming of mannose residues using α1,2-mannosidases

      • Addition of complex-type glycan structures using human glycosyltransferases

      • Potential introduction of terminal sialylation enzymes

  • Verification methods:

    • Western blotting of glycoproteins to assess glycosylation patterns

    • Mass spectrometry analysis of N-glycan structures

    • Enzymatic sensitivity assays (Endo H resistance as a marker of complex glycans)

The ultimate goal is to engineer Y. lipolytica strains capable of producing glycoproteins with N-glycan structures resembling those found in humans, improving their therapeutic potential.

What are the challenges and solutions for optimizing ALG2 activity in recombinant Y. lipolytica strains?

Optimizing ALG2 activity in recombinant Y. lipolytica strains presents several challenges that require specific solutions:

  • Challenge: Expression level optimization

    • Solution: Use of multi-copy integrative expression vectors with appropriate promoters like pICL1, combined with selection markers such as ura3d4

    • Method: Southern blotting to verify copy number and Western blotting to confirm expression levels

  • Challenge: Proper subcellular localization

    • Solution: Include appropriate ER targeting and retention signals in recombinant constructs

    • Method: Fluorescent tagging and microscopy to verify correct localization

  • Challenge: Balancing glycosylation pathway flux

    • Solution: Co-expression of multiple glycosylation enzymes in appropriate ratios, possibly using diploidization strategies to combine multiple expression cassettes

    • Method: Analysis of glycoprotein products by mass spectrometry to verify desired glycan structures

  • Challenge: Genetic instability of recombinant strains

    • Solution: Use of rDNA or the LTR zeta of Ylt1 as stable integration targeting sequences

    • Method: Monitoring strain stability through multiple generations

  • Challenge: Metabolic burden of heterologous protein expression

    • Solution: Selection of appropriate reference genes unaffected by protein overexpression burden (TEF1, TPI1, UBC2, SRPN2, ALG9-like, RYL1) for accurate expression analysis

    • Method: RT-qPCR with proper normalization to assess expression levels

By addressing these challenges systematically, researchers can develop robust Y. lipolytica strains with optimized ALG2 activity for various biotechnological applications.

How has ALG2 evolved across yeast species, and what do sequence variations reveal about functional adaptations?

Evolutionary analysis of ALG2 across yeast species provides insights into functional adaptations of this essential enzyme. While detailed sequence comparisons of Y. lipolytica ALG2 are not provided in the search results, a comparative genomics approach would reveal:

  • Conservation patterns:

    • Core catalytic domains are likely highly conserved due to the essential function in N-glycosylation

    • Regions involved in protein-protein interactions or regulatory functions may show greater variation

    • Comparison with S. cerevisiae, Pichia pastoris, and other yeasts would highlight lineage-specific adaptations

  • Functional implications of sequence variations:

    • Variations in substrate binding regions may reflect adaptations to different dolichol-linked intermediates

    • Differences in regulatory regions could indicate altered response to cellular conditions

    • Changes in protein interaction domains might suggest species-specific glycosylation complex formation

  • Methodological approach:

    • Multiple sequence alignment of ALG2 from various yeast species

    • Phylogenetic analysis to establish evolutionary relationships

    • Structural modeling to map sequence variations to functional domains

    • Complementation studies to test functional equivalence across species

Understanding these evolutionary patterns could inform glycoengineering strategies by identifying flexible versus constrained regions of the enzyme.

What are the optimal conditions for measuring recombinant Y. lipolytica ALG2 enzymatic activity in vitro?

Establishing optimal conditions for measuring recombinant Y. lipolytica ALG2 enzymatic activity in vitro requires careful consideration of multiple factors:

  • Enzyme preparation:

    • Expression using integrative multi-copy vectors in Y. lipolytica

    • Purification using affinity tags while maintaining native folding

    • Verification of purity by SDS-PAGE and Western blotting

  • Reaction components:

    • Donor substrate: GDP-mannose at optimized concentration

    • Acceptor substrate: GlcNAc2Man1-PP-dolichol or synthetic analogues

    • Buffer conditions: typically pH 6.5-7.5 with divalent cations (Mn²⁺ or Mg²⁺)

    • Detergent: mild non-ionic detergents to maintain enzyme solubility without disrupting activity

  • Assay methods:

    • Radiometric assays using ¹⁴C or ³H-labeled GDP-mannose

    • HPLC or mass spectrometry-based methods to analyze reaction products

    • Coupled enzyme assays measuring GDP release

  • Data analysis:

    • Determination of kinetic parameters (Km, Vmax) for both donor and acceptor substrates

    • Effects of pH, temperature, and ionic conditions on enzyme activity

    • Inhibition studies to characterize active site properties

Optimized in vitro assay conditions provide a foundation for detailed structure-function studies and for screening potential modulators of ALG2 activity.

How can CRISPR-Cas9 genome editing be optimized for targeting ALG2 in Y. lipolytica?

CRISPR-Cas9 genome editing for targeting ALG2 in Y. lipolytica requires optimization of several parameters to achieve high efficiency and specificity:

  • sgRNA design considerations:

    • Target sequences with high on-target and low off-target scores

    • Avoid regions with secondary structure that might interfere with Cas9 binding

    • Select target sites close to the start codon for gene disruption or at specific locations for precise modifications

  • Expression system optimization:

    • Use promoters that function efficiently in Y. lipolytica for both Cas9 and sgRNA expression

    • Consider using RNA polymerase III promoters (like SNR52) for sgRNA expression

    • Optimize Cas9 expression using codon-optimized sequences for Y. lipolytica

  • Delivery method:

    • Transformation protocols using lithium acetate or electroporation

    • Integrative vectors for stable expression of Cas9 and sgRNA

    • Use of appropriate selection markers (e.g., ura3d4 for multi-copy integration)

  • Repair template design:

    • For precise modifications, design homology-directed repair templates with appropriate homology arm lengths (typically 500-1000 bp)

    • Include selection markers or screenable phenotypes to facilitate identification of edited clones

  • Verification of edits:

    • PCR screening followed by sequencing

    • Phenotypic analysis based on expected glycosylation defects

    • Western blotting of model glycoproteins to assess altered glycosylation patterns

Optimized CRISPR-Cas9 protocols enable precise genetic modifications for functional studies of ALG2 and for engineering Y. lipolytica strains with desired glycosylation properties.

How can metabolic flux analysis be applied to understand the impact of ALG2 expression levels on N-glycan biosynthesis?

Metabolic flux analysis (MFA) can provide valuable insights into how ALG2 expression levels influence N-glycan biosynthesis in Y. lipolytica:

  • Experimental design approach:

    • Create strains with varying ALG2 expression levels using multi-copy integration systems

    • Implement isotope labeling strategies using ¹³C-glucose or ¹³C-mannose

    • Monitor incorporation of labeled precursors into lipid-linked oligosaccharides and protein N-glycans

  • Analytical techniques:

    • LC-MS/MS analysis of glycan structures and isotope incorporation patterns

    • Quantitative PCR to correlate ALG2 expression levels with observed flux changes

    • Enzyme activity assays to verify that expression differences translate to functional changes

  • Data interpretation framework:

    • Mathematical modeling of the glycosylation pathway

    • Identification of rate-limiting steps and bottlenecks

    • Correlation analysis between ALG2 activity, LLO synthesis rates, and final glycan structures

  • Applications of findings:

    • Optimization of expression levels for desired glycosylation outcomes

    • Identification of complementary targets for pathway engineering

    • Prediction of glycosylation changes under various growth conditions

This systems biology approach provides a comprehensive understanding of how ALG2 functions within the broader context of cellular metabolism and glycosylation pathways.

What are the effects of ALG2 overexpression on ER stress responses in Y. lipolytica?

Overexpression of ALG2 in Y. lipolytica may impact ER homeostasis and stress responses due to altered glycosylation flux:

Understanding these effects is crucial for developing robust Y. lipolytica strains for glycoprotein production that maintain ER homeostasis despite altered glycosylation pathway activity.

What are common challenges in detecting Y. lipolytica ALG2 expression and activity, and how can they be addressed?

Researchers working with recombinant Y. lipolytica ALG2 often encounter several challenges in detecting expression and activity. Here are key challenges and their solutions:

  • Challenge: Low expression levels

    • Solution: Optimize codon usage for Y. lipolytica and use strong inducible promoters like pICL1

    • Solution: Implement multi-copy integration strategies using selectable markers like ura3d4

    • Detection method: Western blotting with highly sensitive detection systems or epitope tagging

  • Challenge: Protein misfolding or instability

    • Solution: Express ALG2 as a fusion with solubility-enhancing tags

    • Solution: Optimize growth temperature and induction conditions

    • Detection method: Analysis of protein solubility in different subcellular fractions

  • Challenge: Measuring enzymatic activity

    • Solution: Develop sensitive assays using labeled substrates

    • Solution: Use indirect measurements such as complementation of ALG2-deficient strains

    • Detection method: Analysis of LLO structures or N-glycan profiles by mass spectrometry

  • Challenge: Distinguishing endogenous from recombinant activity

    • Solution: Generate ALG2 knockout strains as expression hosts

    • Solution: Use epitope tags or purification handles on recombinant ALG2

    • Detection method: Activity assays with immunoprecipitated enzyme

  • Challenge: Selecting appropriate reference genes for expression analysis

    • Solution: Use validated reference genes like SEC62, TPI1, and IPP1 for RT-qPCR normalization

    • Detection method: Validated RT-qPCR protocols with appropriate controls

By systematically addressing these challenges, researchers can reliably detect and characterize recombinant Y. lipolytica ALG2 expression and activity for various experimental applications.

What emerging technologies could advance our understanding of ALG2 function in Y. lipolytica glycoengineering?

Several cutting-edge technologies show promise for advancing our understanding of ALG2 function in Y. lipolytica glycoengineering:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural determination of ALG2 alone and in complex with substrates

    • Visualization of ALG2 within the context of glycosylation complexes

    • Insights into conformational changes during catalysis

  • Proximity labeling proteomics:

    • Identification of ALG2 interaction partners using BioID or APEX2 fusion proteins

    • Mapping of the dynamic glycosylation complex network

    • Discovery of novel regulatory proteins influencing ALG2 activity

  • Single-cell glycomics:

    • Analysis of cell-to-cell variation in glycosylation patterns

    • Correlation of ALG2 expression levels with glycan structures at the single-cell level

    • Understanding of stochastic effects in glycosylation pathways

  • Genome-scale glycoengineering:

    • CRISPR-based screens to identify genetic modifiers of ALG2 function

    • Multiplex genome editing to optimize glycosylation pathways

    • Development of synthetic glycosylation circuits with tunable outputs

  • In vitro reconstitution of glycosylation complexes:

    • Assembly of minimal functional glycosylation machinery

    • Systematic analysis of component interactions and dependencies

    • Development of cell-free glycoprotein synthesis systems

  • Machine learning approaches:

    • Prediction of glycan structures based on ALG2 sequence variations

    • Optimization of expression conditions for desired glycosylation outcomes

    • Integration of multi-omics data to model glycosylation pathway dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.