Recombinant Yarrowia lipolytica Altered inheritance of mitochondria protein 11 (AIM11)

What is AIM11 and what is its structural organization in Yarrowia lipolytica?

AIM11 (Altered inheritance of mitochondria protein 11) is a membrane protein in Yarrowia lipolytica, specifically identified as a multi-pass membrane protein . The protein consists of 158 amino acids with the sequence: MKFRFGEGAEGTLNTSVTTAMIDQEKRAADLKRRKNQMLLFGGATLATLASC RLTARGISSRRYIPKMFQANHMPPQSDMVKEAAMAVVFATTMALSSFSMVVFGVAWSQDVTSLKQFAL KMKTKLGAQQIEDEIRNAPMTPETQDLQDQLAGALKKD . It belongs to the AIM11 protein family and is encoded by the AIM11 gene (ordered locus name: YALI0F22367g) in Y. lipolytica strain CLIB 122/E 150 . The protein's membrane-spanning domains suggest it plays a role in mitochondrial membrane organization, which is critical for proper mitochondrial inheritance and function.

What techniques are most effective for detecting endogenous AIM11 protein expression in Yarrowia lipolytica?

For detecting endogenous AIM11 in Y. lipolytica, researchers should employ a multi-faceted approach:

• Western blotting: Using antibodies specific to AIM11 or epitope-tagged versions of the protein. This approach has been successfully used for detecting expression of other mitochondrial proteins in Y. lipolytica .

• Fluorescence microscopy: By creating GFP or other fluorescent protein fusions with AIM11, researchers can visualize its subcellular localization. This technique is particularly valuable for membrane proteins like AIM11.

• Mass spectrometry: For unbiased protein identification and quantification, particularly when studying protein complexes associated with mitochondrial membranes.

• RT-qPCR: For monitoring AIM11 mRNA expression levels under different conditions, though this doesn't directly confirm protein expression.

When working with membrane proteins like AIM11, optimization of extraction conditions is critical. The use of appropriate detergents and membrane fractionation techniques is essential to maintain protein structure and function during analysis.

How can homologous recombination efficiency be optimized for targeted modification of the AIM11 gene in Yarrowia lipolytica?

Optimizing homologous recombination efficiency for AIM11 modification requires a multi-strategy approach:

• Disruption of non-homologous end-joining (NHEJ): Deleting the ku70 gene can significantly improve homologous recombination frequency. In Y. lipolytica, this approach has increased HR frequency to over 46% even with short homology regions (50 bp) .

• Cell cycle synchronization: Treating cells with hydroxyurea to synchronize them in S-phase enhances homologous recombination. This chemical approach has proven effective in Y. lipolytica .

• Homology arm length optimization: For AIM11 modification, using homology arms of at least 50 bp, but preferably 100 bp or longer, significantly improves targeting efficiency .

• Marker selection strategies: The URA3 marker has been effectively used for selection in Y. lipolytica, with 100% frequency of marker excision observed when flanked by 100 bp homology regions .

By combining these approaches, researchers have achieved gene deletion frequencies of up to 60% and integration frequencies of around 53% in Y. lipolytica , which could be applied to AIM11 modifications.

What phenotypic changes might be expected when AIM11 is deleted in Yarrowia lipolytica?

When considering AIM11 deletion, researchers should examine several potential phenotypic changes:

• Mitochondrial morphology and distribution: As AIM11 is involved in mitochondrial inheritance, its deletion may lead to abnormal mitochondrial morphology, aggregation, or uneven distribution during cell division.

• Respiratory capacity: Given Y. lipolytica's strict aerobic nature , disruption of mitochondrial proteins like AIM11 may impact respiratory efficiency, which can be measured using oxygen consumption assays or growth rates on different carbon sources.

• Lipid metabolism alterations: Y. lipolytica is an oleaginous yeast , and mitochondrial dysfunction often affects lipid metabolism. Studies with other mitochondrial protein deletions in Y. lipolytica have shown significant changes in lipid accumulation .

• Growth defects: Depending on AIM11's essentiality, deletion may cause growth defects, particularly under stress conditions. For example, deletion of the mitochondrial isocitrate dehydrogenase gene (IDH2) unexpectedly increased lipid accumulation , illustrating the complex interplay between mitochondrial proteins and cellular metabolism.

The strictly aerobic nature of Y. lipolytica makes it particularly sensitive to mitochondrial perturbations compared to S. cerevisiae , so careful phenotypic characterization across multiple growth conditions is essential.

How can CRISPR-Cas9 technology be adapted for precise editing of the AIM11 gene in Yarrowia lipolytica?

CRISPR-Cas9 implementation for AIM11 editing in Y. lipolytica requires several optimizations:

• Vector design: Develop expression vectors containing Cas9 and sgRNA targeting AIM11, with promoters optimized for Y. lipolytica. The isocitrate lyase promoter (pICL1) has been successfully used for heterologous gene expression in this yeast .

• sgRNA design: Design guide RNAs specific to the AIM11 locus with minimal off-target effects. Multiple sgRNAs targeting different regions can increase editing efficiency.

• Delivery method: Transformation protocols must be optimized for Y. lipolytica. Both integrative and CRISPRi approaches have been successfully demonstrated in Y. lipolytica .

• Repair template design: For precise modifications, provide repair templates with homology arms flanking the cut site. Recent studies have demonstrated successful gene targeting in Y. lipolytica with relatively short homology regions (50 bp) .

• Alternative approaches: RNA interference (RNAi) has recently been established in Y. lipolytica with varying silencing strengths achieved by adjusting shRNA length . This provides another option for AIM11 downregulation if complete knockout is not desired.

For optimal results, combining CRISPR editing with strategies to enhance homologous recombination, such as synchronizing cells in S-phase with hydroxyurea and inhibiting the NHEJ pathway , should be considered.

What are the optimal methods for purifying recombinant AIM11 protein from Yarrowia lipolytica?

Purification of recombinant AIM11 poses challenges due to its multi-pass membrane nature . A systematic approach should include:

• Expression system optimization:

  • Use strong inducible promoters like pICL1 (isocitrate lyase promoter)

  • Consider adding affinity tags (His6-tag has been successfully used for other Y. lipolytica proteins)

  • Express in a haploid Y. lipolytica strain for consistent expression

• Membrane protein extraction:

  • Optimal cell disruption using glass beads or enzymatic methods

  • Solubilization with detergents appropriate for multi-pass membrane proteins (e.g., DDM, LMNG)

  • Careful pH and salt concentration optimization to maintain protein stability

• Purification strategy:

  • Two-step affinity chromatography using N-terminal tags

  • Size exclusion chromatography to ensure purity and proper folding

  • Consider lipid reconstitution to maintain native structure

• Quality control:

  • Western blotting to confirm identity

  • Circular dichroism to assess secondary structure

  • Mass spectrometry for accurate molecular weight determination

For functional studies of AIM11, maintaining the native membrane environment during purification is critical. Addition of phospholipids during purification may be necessary, as demonstrated with other Y. lipolytica membrane proteins where activity was restored by adding phosphatidylcholine .

What computational approaches can be used to predict the structure and function of AIM11?

Computational analysis of AIM11 should employ multiple complementary approaches:

• Sequence-based analysis:

  • Transmembrane domain prediction using TMHMM, Phobius, or TOPCONS

  • Motif identification using PROSITE or MEME

  • Disorder prediction using IUPred or PONDR

  • Signal peptide prediction using SignalP

• Evolutionary analysis:

  • Phylogenetic comparison with AIM11 homologs across fungal species

  • Conservation analysis to identify functionally important residues

  • Coevolution analysis to identify potential interaction partners

• Structural modeling:

  • Template-based modeling using homologous proteins with known structures

  • Ab initio modeling for unique regions

  • Molecular dynamics simulations to assess stability in membrane environments

  • Integration of experimental constraints from cross-linking or limited proteolysis

• Functional prediction:

  • Protein-protein interaction prediction using tools like STRING

  • Gene ontology term prediction based on homology and domain architecture

  • Systems biology approaches to predict pathway involvement

The multi-pass membrane nature of AIM11 presents challenges for structural prediction, so combining multiple approaches and validating predictions experimentally is essential.

What imaging techniques best visualize AIM11 localization and dynamics in living Yarrowia lipolytica cells?

For visualizing AIM11 in living Y. lipolytica cells, researchers should consider:

• Fluorescent protein fusions:

  • C- or N-terminal GFP/mCherry fusions with AIM11, ensuring the tag doesn't interfere with membrane insertion

  • Verification that the fusion protein maintains native localization and function

  • Use of photoactivatable or photoswitchable fluorescent proteins for dynamic studies

• Advanced microscopy techniques:

  • Confocal microscopy for basic localization studies

  • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility within membranes

  • FRET (Förster Resonance Energy Transfer) to study protein-protein interactions

  • Super-resolution microscopy (PALM/STORM) for nanoscale localization

• Live-cell imaging optimizations:

  • Selection of appropriate growth media to minimize autofluorescence

  • Microfluidic devices for long-term imaging with controlled environments

  • Dual labeling with mitochondrial markers to confirm subcellular localization

• Image analysis approaches:

  • Quantitative colocalization analysis with known mitochondrial markers

  • Tracking of AIM11 dynamics during cell division and mitochondrial inheritance

  • 3D reconstruction to understand spatial organization within mitochondrial membranes

When studying mitochondrial membrane proteins like AIM11 in Y. lipolytica, it's crucial to minimize phototoxicity to prevent artifacts in mitochondrial morphology and function.

How does AIM11 potentially interact with other proteins in the mitochondrial membrane of Yarrowia lipolytica?

Understanding AIM11's interaction network requires multiple complementary approaches:

• Affinity purification coupled with mass spectrometry (AP-MS):

  • Expression of tagged AIM11 in Y. lipolytica

  • Optimization of crosslinking conditions to capture transient interactions

  • Gentle solubilization to maintain native protein complexes

  • Mass spectrometry analysis to identify co-purifying proteins

• Genetic interaction screening:

  • Synthetic genetic array (SGA) analysis with AIM11 deletion/mutation

  • Suppressor screens to identify genes that rescue AIM11 mutant phenotypes

  • CRISPR-based genetic interaction mapping

• Proximity labeling approaches:

  • BioID or APEX2 fusions with AIM11 to label proximal proteins in vivo

  • Optimization of labeling conditions for mitochondrial membrane proteins

  • MS identification of biotinylated proteins

• Targeted approaches:

  • Yeast two-hybrid screening with membrane-based variants

  • Co-immunoprecipitation with suspected interaction partners

  • FRET analysis between AIM11 and candidate interactors

Given Y. lipolytica's strict dependence on mitochondrial function , AIM11 likely interacts with proteins involved in mitochondrial inheritance, membrane organization, or respiratory complex assembly. Comparison with known interactors of AIM-family proteins in other yeasts can guide candidate selection for targeted studies.

How can metabolomic approaches help understand AIM11's impact on mitochondrial function?

Metabolomic analysis of AIM11 mutants should incorporate:

• Targeted metabolomics:

  • Quantification of TCA cycle intermediates

  • Analysis of mitochondrial membrane lipids

  • Measurement of NAD+/NADH and ATP/ADP ratios

  • Quantification of reactive oxygen species (ROS)

• Untargeted metabolomics:

  • Global metabolite profiling using LC-MS/MS

  • Pathway enrichment analysis to identify affected metabolic networks

  • Time-course studies to capture dynamic metabolic changes

  • Comparison between different carbon sources to assess metabolic flexibility

• Isotope labeling experiments:

  • 13C-labeling to track carbon flux through central metabolism

  • Tracing experiments to determine compartment-specific metabolic activities

  • Pulse-chase experiments to measure turnover rates of specific metabolites

• Integration with other -omics data:

  • Correlation of metabolite changes with transcriptomic and proteomic data

  • Flux balance analysis incorporating enzyme activities

  • Network modeling to predict systemic effects of AIM11 perturbation

Y. lipolytica's unique metabolic capabilities, including its oleaginous nature and obligate aerobic metabolism , make it particularly suitable for studying how mitochondrial membrane proteins like AIM11 influence global metabolic networks.

How can the RE-AIM framework be applied to evaluate AIM11 research experimental designs?

The RE-AIM framework (Reach, Effectiveness, Adoption, Implementation, and Maintenance) can be adapted to evaluate AIM11 research as follows:

• Reach: Assess how broadly applicable the experimental findings are across:

  • Different Y. lipolytica strains and genetic backgrounds

  • Varying growth conditions and stress responses

  • Related yeast species to determine evolutionary conservation

• Effectiveness: Evaluate the robustness of experimental outcomes:

  • Statistical power analysis to ensure sufficient replication

  • Effect size calculations for observed phenotypic changes

  • Validation using complementary methodological approaches

  • Control experiments to rule out off-target effects

• Adoption: Consider how easily methods can be adopted by other researchers:

  • Standardization of protocols for AIM11 manipulation

  • Development of optimized genetic tools specific for mitochondrial membrane proteins

  • Creation of validated reagents (plasmids, antibodies, strains)

• Implementation: Address challenges in experimental implementation:

  • Optimization of techniques for membrane protein analysis

  • Development of high-throughput screening methods

  • Refinement of imaging approaches for mitochondrial dynamics

• Maintenance: Evaluate long-term stability and reproducibility:

  • Assessment of phenotypic stability across generations

  • Development of preservation methods for genetically modified strains

  • Data management practices for complex multi-omics datasets

The RE-AIM framework helps in "addressing the realist evaluation question of what intervention components are effective, with which implementation strategies, for whom, in what settings, how and why, and for how long" , which is crucial for designing robust AIM11 experiments that produce reproducible and biologically meaningful results.

How can AIM11 be utilized in heterologous protein expression systems in Yarrowia lipolytica?

AIM11's relationship to mitochondrial function presents opportunities for optimized heterologous protein expression:

• Mitochondrial targeting strategies:

  • Using AIM11's native mitochondrial targeting sequence to direct heterologous proteins to mitochondria

  • Engineering hybrid targeting sequences combining AIM11 elements with other targeting motifs

  • Leveraging AIM11 membrane domains for membrane protein expression

• Expression vector optimization:

  • Multi-copy integration approaches for stable expression

  • Strategic promoter selection based on desired expression timing and level

  • Diploidization strategies to combine multiple expression cassettes

• Co-expression systems:

  • Development of co-expression vectors incorporating AIM11 with heterologous proteins

  • Balancing expression levels through promoter engineering

  • Sequential transformation approaches for complex multi-protein systems

The successful expression of mammalian cytochrome P450 systems in Y. lipolytica using similar approaches suggests potential for using AIM11-based systems for membrane protein expression, particularly for proteins that require mitochondrial localization or membrane association.

What role might AIM11 play in mitochondrial DNA maintenance in Yarrowia lipolytica?

Investigation of AIM11's potential role in mtDNA maintenance should consider:

• Mitochondrial nucleoid association:

  • Analysis of AIM11 co-localization with mitochondrial nucleoids

  • ChIP-seq or similar approaches to detect potential DNA binding

  • Comparison with known mtDNA maintenance factors like YlMhb1p, the principal mt-nucleoid component in Y. lipolytica

• mtDNA stability assessment:

  • Quantification of mtDNA copy number in AIM11 mutants

  • Analysis of mtDNA deletion frequency and heteroplasmy levels

  • Assessment of mitochondrial transcription efficiency

• Mitochondrial nucleoid architecture:

  • Super-resolution microscopy to examine nucleoid structure

  • Protein-protein interaction studies with known nucleoid components

  • Biochemical fractionation to determine AIM11's association with nucleoid fractions

Y. lipolytica's strict aerobic nature and dependence on functional mitochondria make it an excellent model for studying proteins involved in mtDNA maintenance. While AIM11 is primarily characterized as a membrane protein , many membrane proteins play indirect roles in nucleoid organization and mtDNA stability.

What approaches can be used to study AIM11's role in Y. lipolytica's strict aerobic metabolism?

To investigate AIM11's contribution to Y. lipolytica's obligate aerobic lifestyle:

• Respiratory chain analysis:

  • Measurement of oxygen consumption rates in AIM11 mutants

  • Assessment of individual respiratory complex activities

  • Blue-native PAGE analysis of respiratory supercomplexes

  • Mitochondrial membrane potential measurements

• Comparative analysis across yeast species:

  • Functional complementation studies with AIM homologs from facultative anaerobic yeasts

  • Creation of chimeric proteins to identify domains responsible for Y. lipolytica-specific functions

  • Evolutionary analysis of AIM11 sequence divergence in aerobic vs. facultative yeasts

• Stress response characterization:

  • Survival under various metabolic stresses (oxidative, nutrient limitation)

  • Adaptation capabilities to changing oxygen levels

  • Mitochondrial morphology changes under stress conditions

• Metabolic flexibility assessment:

  • Growth profiling on different carbon sources

  • Carbon flux analysis using labeled substrates

  • Metabolic network modeling incorporating AIM11 function

Understanding AIM11's role may provide insights into Y. lipolytica's inability to form viable petite mutants , a characteristic that distinguishes it from facultative anaerobic yeasts like S. cerevisiae and highlights the essential nature of its mitochondrial functions.