Recombinant Yarrowia lipolytica Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock
Cat. No.
BT2476883
Source
in vitro E.coli expression system
Synonyms
RCF1; AIM31; YALI0C16456g; Respiratory supercomplex factor 1, mitochondrial
Quick Inquiry

Description

Introduction to Yarrowia lipolytica AIM31

Yarrowia lipolytica is a yeast known for its ability to produce various metabolites, including proteins, lipids, and organic acids . Y. lipolytica has a fully functional mitochondrial genome, making it a suitable organism for studying mitochondrial functions . Recombinant Yarrowia lipolytica Altered Inheritance of Mitochondria protein 31, mitochondrial (AIM31) is a protein component of Yarrowia lipolytica .

AIM31 Overview

AIM31 is a mitochondrial protein found in Yarrowia lipolytica . The protein is also known as Altered inheritance of mitochondria protein 31, mitochondrial .

Basic Information:

  • Name: Recombinant Yarrowia lipolytica Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

  • Organism: Yarrowia lipolytica (strain CLIB 122 / E 150)

  • UniProt No.: Q6CBQ8

AA Sequence:
MSDLPSSFDNGNSIDENEKSPGYYKILERCKEQPLVPLGCLATCGALILSARALRVGNKRQANRMFFARVAFQGLTVAALIGGAMYYGQDPKQKLEQKEREKmLARHREKLWIEELERRDLEVQERRKRAAAFRQQEEEK

Table 1: Suppliers

SupplierTelCountryProdListAdvantage
CUSABIO TECHNOLOGY LLC027-87196173China3304458

Role of AIM31 in Mitochondrial Function

Yarrowia lipolytica serves as a model for analyzing mitochondrial complex I . Y. lipolytica is a strictly aerobic species, dependent on a functional mitochondrial genome . Mitochondrial DNA (mtDNA) within the mitochondria is compacted into DNA-protein structures called mitochondrial nucleoids (mt-nucleoids) .

Genetic Tools and Manipulation

Genetic tools have been developed to study the genetics of Y. lipolytica . Complex I deletion strains can be created, and the deleted genes can be complemented using shuttle plasmids . These tools are useful for site-directed mutagenesis of individual subunits of Y. lipolytica complex I, allowing for the identification of functionally important amino acids .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RCF1; AIM31; YALI0C16456g; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
RCF1
Target Protein Sequence
MSDLPSSFDNGNSIDENEKSPGYYKILERCKEQPLVPLGCLATCGALILSARALRVGNKR QANRMFFARVAFQGLTVAALIGGAMYYGQDPKQKLEQKEREKMLARHREKLWIEELERRD LEVQERRKRAAAFRQQEEEK
Uniprot No.
Q6CBQ8

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links

KEGG: yli:YALI0C16456g

STRING: 4952.XP_501904.2

Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.