Recombinant Yarrowia lipolytica Assembly factor CBP4 (CBP4)

What is Yarrowia lipolytica Assembly factor CBP4 and what is its biological function?

Assembly factor CBP4 (Cytochrome b mRNA-processing protein 4) is a 146-amino acid protein found in the yeast Yarrowia lipolytica, identified with UniProt ID Q6C5S0. This protein is encoded by the gene CBP4 (also known as YALI0E15686g) and is involved in mitochondrial processes, specifically in the assembly or processing of cytochrome b, which is an essential component of the respiratory chain complex III in mitochondria . Based on its homology to similar proteins in other yeast species, CBP4 likely plays a critical role in mitochondrial function and potentially in energy metabolism, which is particularly significant given Y. lipolytica's unique metabolic capabilities.

How does CBP4's structure relate to its function in Y. lipolytica?

The full amino acid sequence of Y. lipolytica CBP4 is: MRLENWPIVEMFRSRPGVPNWPKFGLFAVGVIGSAYLGYRYATPSEEDIVRRMNPELRER YMLERDARQEYFNEFVKEAIAQSKTNEPIWKVGPMASKPIDFNVAVREKMKEIEARNDQD RNERIKNELAAIAKKEEEEKNKKGWW . While the detailed three-dimensional structure has not been fully elucidated in the provided search results, structural analysis suggests that CBP4 contains transmembrane domains that likely facilitate its localization to mitochondrial membranes, which is consistent with its role in cytochrome b processing. Research methodologies to further characterize its structure would include X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy of purified recombinant CBP4.

What is known about CBP4 expression patterns across different Y. lipolytica growth phases?

While the search results don't specifically detail CBP4 expression patterns, Y. lipolytica has been shown to dramatically alter its proteome during different growth phases and when utilizing different carbon sources . Proteomic studies indicate that Y. lipolytica strains exhibit distinctive protein abundance changes between exponential and stationary growth phases, particularly when transitioning from glucose to xylose metabolism . Researchers investigating CBP4 expression should consider designing experiments that sample multiple growth phases and carbon source conditions to determine whether CBP4 is differentially expressed, which could provide insights into its regulatory mechanisms and physiological significance.

What are the optimal expression and purification protocols for recombinant Y. lipolytica CBP4?

For successful expression and purification of recombinant Y. lipolytica CBP4:

• Expression System: E. coli is the validated expression system for recombinant CBP4 production, typically using a vector that allows for N-terminal His-tag fusion .

• Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins

  • Elution with imidazole gradient

  • Additional purification by size exclusion chromatography if higher purity is required

• Quality Control: SDS-PAGE analysis to confirm purity (>90% purity is typically achievable) .

What are the optimal storage and handling conditions for recombinant CBP4?

To maintain the structural integrity and activity of recombinant CBP4:

• Long-term Storage:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

• Reconstitution Protocol:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage aliquots (50% is the default recommendation)

• Working Conditions:

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

What analytical methods are most effective for studying CBP4's interactions with other mitochondrial proteins?

For investigating CBP4's protein-protein interactions in mitochondrial contexts:

• Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag or specific CBP4 epitopes to pull down protein complexes.

• Proximity Labeling: BioID or APEX2 fusions to CBP4 can identify proximal proteins in the native cellular environment.

• Crosslinking Mass Spectrometry (XL-MS): Chemical crosslinking followed by MS analysis can identify direct interaction partners and interface regions.

• Yeast Two-Hybrid Screening: Modified for membrane proteins, this method can identify potential interactors from a library.

• Functional Assays: Reconstitution of purified CBP4 with candidate interacting proteins to assess functional outcomes related to cytochrome b processing.

These methodologies should be adapted considering CBP4's likely membrane association and mitochondrial localization for optimal results.

How might CBP4 function contribute to Y. lipolytica's unique metabolic capabilities?

Y. lipolytica is known for its ability to accumulate remarkable amounts of neutral lipids (up to 40% of cell weight) and its robustness in stressful environments, including tolerance to chemical inhibitors, broad pH ranges, high salt concentrations, and organic solvents . As a mitochondrial protein likely involved in respiratory chain assembly, CBP4 may play a critical role in energy metabolism that underpins these unique capabilities.

Experimental approaches to investigate this connection include:

• Comparative Proteomics: Analyze CBP4 expression levels in different Y. lipolytica strains with varying lipid accumulation phenotypes, such as CBS7504 and YB420, which show distinct lipid metabolism patterns during xylose assimilation .

• Genetic Manipulation: Generate CBP4 knockout or overexpression strains and assess impacts on:

  • Respiratory capacity (oxygen consumption rates)

  • Growth on different carbon sources

  • Lipid accumulation patterns

  • Stress resistance profiles

• Metabolic Flux Analysis: Use isotopic labeling to trace carbon flow through central metabolic pathways in wild-type versus CBP4-modified strains to determine if CBP4 influences the distribution of carbon between respiration, lipid synthesis, and other pathways.

What role might CBP4 play in Y. lipolytica's adaptation to different carbon sources?

Proteomic studies have shown that Y. lipolytica dramatically alters its proteome when transitioning from glucose to xylose metabolism . If CBP4 is involved in mitochondrial function, it may be differentially regulated during these metabolic shifts. Research methodologies to explore this connection include:

• Transcriptional Analysis: Quantify CBP4 mRNA levels during growth on different carbon sources using RT-qPCR or RNA-seq.

• Proteome Profiling: Compare CBP4 protein abundance across different carbon source conditions using quantitative proteomics approaches like SILAC or TMT labeling.

• Functional Assays: Assess mitochondrial function (membrane potential, respiratory capacity, ATP production) in relation to CBP4 expression levels under different carbon source conditions.

• Comparative Analysis: Investigate whether CBP4 expression or function differs between Y. lipolytica strains with varying abilities to utilize non-preferred sugars like xylose, such as the differences observed between CBS7504 and YB420 strains .

How does CBP4 vary across different Y. lipolytica strains and what functional implications might this have?

Y. lipolytica exhibits genetic diversity across different strains, with gene counts varying between 7,728 and 7,769 genes in MATA (E122) and MATB (22301-5) strains, respectively . Comparative genomic and proteomic analyses can reveal strain-specific variations in CBP4 sequence, expression, or regulation that might correlate with phenotypic differences.

Research approaches to investigate strain variation include:

• Sequence Comparison: Analyze CBP4 coding and regulatory regions across different Y. lipolytica strains (such as CBS7504, YB420, E122, and 22301-5) to identify polymorphisms.

• Expression Analysis: Compare CBP4 expression levels across strains under standardized conditions to identify regulatory differences.

• Functional Complementation: Test whether CBP4 from one strain can functionally complement a CBP4 deletion in another strain to assess functional conservation.

What are the key methodological challenges in studying CBP4 function in Y. lipolytica?

Researchers face several technical challenges when investigating CBP4 in Y. lipolytica:

• Mitochondrial Localization: As a likely mitochondrial protein, studying CBP4 in its native context requires specialized techniques for mitochondrial isolation and subfractionation.

• Membrane Association: If CBP4 is membrane-associated, this creates challenges for protein solubilization and purification while maintaining native conformation and activity.

• Functional Assays: Developing specific assays to measure CBP4's activity in cytochrome b processing requires sophisticated biochemical approaches.

• Genetic Manipulation: While genetic tools for Y. lipolytica are improving, they are still less developed than those for conventional yeast models, potentially complicating genetic studies of CBP4.

How might proteomics approaches advance our understanding of CBP4 function in Y. lipolytica?

Proteomics has already provided valuable insights into Y. lipolytica biology, revealing proteome alterations during different growth phases and carbon source utilization . Similar approaches can be applied specifically to CBP4 research:

• Interaction Proteomics: Techniques like BioID, APEX2 proximity labeling, or co-immunoprecipitation coupled with mass spectrometry can identify CBP4 interaction partners.

• Post-translational Modifications (PTMs): Phosphoproteomics or other PTM-specific analyses can reveal regulatory modifications of CBP4 under different conditions.

• Quantitative Proteomics: SILAC, TMT, or label-free quantification can measure changes in CBP4 abundance across different genetic backgrounds, environmental conditions, or growth phases.

• Spatial Proteomics: Techniques combining subcellular fractionation with proteomics can confirm CBP4's localization and potential redistribution under different conditions.