Recombinant Yarrowia lipolytica ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

ATP synthase subunit a (encoded by ATP6) is a transmembrane component of mitochondrial Complex V (ATP synthase). It facilitates proton translocation across the inner mitochondrial membrane, driving ATP synthesis via rotational catalysis . In Y. lipolytica, subunit a interacts with the c-ring rotor and subunits 8 (A6L in humans) to form the proton-conducting channel . Recombinant versions enable mechanistic studies without native purification challenges.

Key Features of Recombinant ATP6

PropertyDetails
UniProt IDQ36258
Expression SystemBaculovirus
Purity>85% (SDS-PAGE)
DomainsPartial sequence; includes transmembrane helices critical for proton transport
Structural PartnersSubunit 8 (A6L), c-ring, and peripheral stalk subunits

Mechanistic Impact:

  • Mutations in helix H4–H5 disrupt proton channel architecture, reducing ATP synthesis efficiency .

  • Severe mutations (e.g., aH185R) destabilize F<sub>O</sub> assembly, while mild variants permit residual function .

Recombinant ATP6 Workflow

  1. Cloning: Partial ATP6 gene inserted into baculovirus vectors.

  2. Expression: Expressed in insect cells, leveraging post-translational modifications.

  3. Purification: Detergent solubilization, digitonin-based gradient centrifugation, and anion-exchange chromatography.

  4. Storage: Lyophilized or liquid forms at -20°C/-80°C; reconstituted with 50% glycerol for stability .

Applications in Research

  • Disease Modeling: Used to characterize pathogenicity of MT-ATP6 mutations linked to mitochondrial encephalopathies .

  • Structural Analysis: Facilitates cryo-EM and X-ray crystallography studies of ATP synthase dimers .

  • Drug Screening: Tests compounds targeting proton channel defects in ATP synthase .

Limitations and Future Directions

  • Partial Sequence: Current recombinant ATP6 lacks full-length structure, limiting studies on interdomain interactions .

  • Thermostability: Mutations like aT195A reduce function at higher temperatures, suggesting conformational fragility .

  • Need for Humanized Models: Yeast-based systems require cross-validation with human cell assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
7-255
Protein Length
Full Length of Mature Protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
ATP6
Target Protein Sequence
SPLEQFTTRVYFGLSSGLINLDTITLTSFSIYSIAVVALILGFSILNDNNTNILPTRWSL AFESLYFTVEKMVSEQIGGLEGRLLFPFMFSLFMYILIANVVSLVPYSYAINAQLIWTIG LSVAIWIGCTLTGLANHGAKFFGLFLPSGTNLPLVPVLVIIELLSYIARALSLGLRLGSN ILAGHLLLVILAGLILNFISISIFTFALGILPLSILLGIVALESAIAFIQAIVFTILTCS YIKDAIHLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes of the respiratory chain. F-type ATP synthases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (ATP6) in Yarrowia lipolytica and why is it significant for research?

ATP synthase subunit a (ATP6) is an essential component of the mitochondrial ATP synthase complex in Yarrowia lipolytica. This membrane protein forms part of the F0 portion of ATP synthase and plays a critical role in proton channel formation. The full-length mature protein spans amino acids 7-255 with a specific amino acid sequence that includes numerous hydrophobic regions essential for its membrane integration and function .

The significance of this protein lies in its central role in cellular bioenergetics, particularly in oxidative phosphorylation. As part of the ATP synthase complex, ATP6 contributes to the proton gradient-driven synthesis of ATP, the primary energy currency in cells. Studying recombinant forms of this protein allows researchers to investigate fundamental aspects of bioenergetics, membrane protein structure-function relationships, and potential applications in biotechnology.

What expression systems are commonly used for recombinant Y. lipolytica ATP6 production?

Two main expression systems are commonly employed for recombinant Y. lipolytica ATP6 production:

  • E. coli expression system: This heterologous system allows for the expression of recombinant full-length Y. lipolytica ATP6 fused to an N-terminal His tag. This approach facilitates purification through affinity chromatography and produces protein with greater than 90% purity as determined by SDS-PAGE .

  • Homologous expression in Y. lipolytica: A more sophisticated approach involves constructing recombinant Y. lipolytica strains that can express the protein in its native environment. This method employs integrative multi-copy expression vectors that permit the introduction of several expression cassettes into the yeast genome .

The choice between these systems depends on research objectives, with E. coli offering simpler manipulation and potentially higher yields, while homologous expression may provide more native-like protein folding and post-translational modifications.

Why is Yarrowia lipolytica considered an advantageous host for recombinant protein expression?

Yarrowia lipolytica offers several significant advantages as a host for recombinant protein expression:

  • Metabolic versatility: Y. lipolytica can degrade a wide range of hydrophobic substrates, allowing for growth on various carbon sources including waste materials .

  • Genetic accessibility: The yeast has relatively low nutritional requirements and shows high growth potential independent of geographic and weather conditions .

  • Advanced expression systems: Researchers have developed sophisticated methods for constructing recombinant Y. lipolytica strains that permit the introduction of multiple expression cassettes into the yeast genome .

  • Safety profile: Y. lipolytica is classified as Generally Recognized as Safe (GRAS) by the FDA, a Biosafety Level (BSL) 1 microorganism by the Public Health Service, and recognized as a "microorganism with a documented use in food" by the International Dairy Federation and European Food and Feed Cultures Association .

  • Natural occurrence in foods: The yeast is found naturally in various food products including cheese, milk, yogurt, meat products, and others, further supporting its safety for biotechnological applications .

How can multiple expression cassettes be integrated into Y. lipolytica for complex ATP6-related studies?

For complex studies involving ATP6 and its interactions with other proteins, researchers have developed sophisticated approaches for integrating multiple expression cassettes into Y. lipolytica:

  • Multi-copy vector system: This approach utilizes integrative multi-copy expression vectors containing the genes of interest under the control of specific promoters (e.g., isocitrate lyase promoter pICL1).

  • Strategic integration targeting: The method employs basic plasmids like p64PT or p67PT that contain integration targeting sequences (rDNA or LTR zeta of Ylt1) and selection markers such as ura3d4 for multi-copy selection.

  • Two-step integration process:

    • First, simultaneous transformation of up to three expression vectors into haploid recipient strains

    • Subsequently, further combinations through diploidisation using selected haploid multi-copy transformants

This methodology enables researchers to obtain recombinant strains containing three to five different expression cassettes, as confirmed through Southern blotting techniques. The expression of the integrated proteins can be verified by Western blotting .

Table 1: Comparison of Integration Strategies for Multiple Expression Cassettes in Y. lipolytica

StrategyIntegration TargetSelection MarkerMaximum CassettesVerification Method
Single-steprDNA or LTR zetaura3d43Southern blotting
Two-step with diploidisationrDNA or LTR zetaura3d45Southern/Western blotting

How does the dimorphic nature of Y. lipolytica affect recombinant ATP6 expression?

Y. lipolytica exhibits dimorphic growth, transitioning between yeast-like and filamentous forms depending on environmental conditions. This dimorphism has significant implications for recombinant protein expression, including ATP6:

  • Morphological influences on expression:

    • The yeast form (oval and ellipsoidal cells) typically shows different expression characteristics compared to the filamentous form (true filaments and pseudo-hyphae).

    • The creation of dimorphic forms depends primarily on environmental conditions such as alterations in oxygen, pH, carbon, and nitrogen substrates .

  • Protein secretion and localization:

    • Membrane protein targeting and insertion mechanisms may differ between morphological states

    • Cell wall composition changes between forms can affect protein export efficiency

  • Growth and cultivation considerations:

    • Researchers must control growth conditions carefully to maintain consistent morphology during expression

    • Elongation into hyphae may be induced by replacing glucose with N-acetylglucosamine or by adding serum to the medium

What is the optimal protocol for purifying recombinant His-tagged Y. lipolytica ATP6?

Based on experimental data, the following protocol is recommended for purifying recombinant His-tagged Y. lipolytica ATP6:

Purification Protocol:

  • Initial preparation:

    • Harvest E. coli cells expressing His-tagged Y. lipolytica ATP6

    • Resuspend cell pellet in appropriate lysis buffer containing protease inhibitors

    • Disrupt cells via sonication or pressure-based homogenization

  • Membrane isolation:

    • Separate membrane fraction by ultracentrifugation

    • Solubilize membrane proteins using suitable detergents (e.g., n-dodecyl β-D-maltoside or digitonin)

  • Affinity chromatography:

    • Apply solubilized protein to Ni-NTA or similar affinity resin

    • Wash with increasing imidazole concentrations to remove non-specific binding

    • Elute His-tagged ATP6 with high imidazole buffer

  • Further purification:

    • Perform size exclusion chromatography to separate monomeric protein

    • Consider ion exchange chromatography for higher purity if needed

  • Storage and handling:

    • Store the purified protein at -20°C/-80°C

    • Aliquot to avoid repeated freeze-thaw cycles

    • For reconstitution, use deionized sterile water to achieve 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE .

What analytical methods can verify successful expression and proper folding of recombinant ATP6?

Multiple analytical approaches can be employed to verify successful expression and proper folding of recombinant ATP6:

  • Expression verification:

    • SDS-PAGE to confirm protein size and approximate purity (>90%)

    • Western blotting with anti-His antibodies or ATP6-specific antibodies

    • Mass spectrometry for accurate mass determination and sequence verification

  • Folding assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure content

    • Limited proteolysis to assess accessibility of protease cleavage sites

    • Thermal stability assays to determine protein stability

  • Functional verification:

    • Reconstitution into liposomes to assess membrane integration

    • Proton conductance assays to verify channel activity

    • Assembly assays with other ATP synthase components

  • Structural integrity:

    • Detergent screening to identify conditions that maintain native structure

    • Negative stain electron microscopy to visualize protein particles

    • Native gel electrophoresis to assess oligomeric state

These methods in combination provide comprehensive validation of the recombinant protein's expression, folding, and potential functionality.

What are the critical factors for optimizing expression yield of recombinant ATP6?

Optimizing expression yield of recombinant ATP6 requires attention to several critical factors:

  • Vector design optimization:

    • Selection of appropriate promoters (e.g., isocitrate lyase promoter pICL1 for Y. lipolytica)

    • Codon optimization for the expression host

    • Inclusion of appropriate fusion tags (e.g., His-tag) for purification

  • Expression host selection:

    • E. coli for high-yield expression of proteins that don't require eukaryotic modifications

    • Y. lipolytica for proteins requiring eukaryotic processing, with potential for multi-copy integration

    • Consideration of specialized strains designed for membrane protein expression

  • Growth conditions optimization:

    • Temperature (lower temperatures often improve membrane protein folding)

    • Induction timing and concentration

    • Media composition and pH

    • For Y. lipolytica, control of dimorphic state through environmental conditions

  • Multi-copy integration strategies (for Y. lipolytica):

    • Use of integrative multi-copy expression vectors

    • Selection of appropriate integration targeting sequences (rDNA or LTR zeta of Ylt1)

    • Utilization of selection markers like ura3d4

    • Potential diploidisation to combine different expression cassettes

  • Harvest timing:

    • Monitoring growth curves to determine optimal harvest point

    • Consideration of protein degradation versus expression levels

Table 2: Optimization Parameters for Recombinant ATP6 Expression

ParameterE. coli SystemY. lipolytica System
Temperature16-30°C23-28°C
InductionIPTG concentrationCarbon source shift
MediaLB or defined mediaYPD or minimal media
Copy numberPlasmid-dependentMulti-copy integration
Expression time3-24 hours24-72 hours

How can researchers assess the functional activity of recombinant ATP6 in experimental systems?

Assessing the functional activity of recombinant ATP6 requires specialized approaches that consider its role in the ATP synthase complex:

  • Reconstitution systems:

    • Incorporate purified ATP6 into liposomes or nanodiscs

    • Co-reconstitute with other ATP synthase subunits to form partial or complete complexes

    • Measure proton conductance using pH-sensitive dyes or electrodes

  • Complementation studies:

    • Transform ATP6-deficient yeast strains with recombinant ATP6

    • Assess restoration of respiratory growth

    • Measure oxygen consumption and ATP production in complemented strains

  • Biochemical assays:

    • Analyze binding to known ATP synthase inhibitors

    • Investigate interactions with other ATP synthase subunits using pull-down assays

    • Perform crosslinking studies to identify interaction partners

  • Structural integrity assessment:

    • Use electron microscopy to visualize reconstituted ATP synthase complexes

    • Apply single-particle analysis to determine structural features

    • Compare structures with known ATP synthase complexes from other organisms

These functional analyses provide critical insights into the role of ATP6 in ATP synthase assembly and function, validating the biological relevance of the recombinant protein.

What research applications benefit from using Y. lipolytica as a platform for ATP6 studies?

Y. lipolytica offers unique advantages for ATP6 research across multiple applications:

  • Comparative bioenergetics:

    • As an oleaginous yeast with robust mitochondrial function, Y. lipolytica provides insights into energy metabolism adaptations

    • The yeast's ability to grow on various carbon sources enables studies of ATP synthase regulation under different metabolic conditions

    • Comparison with S. cerevisiae reveals evolutionary adaptations in energy conservation mechanisms

  • Structural biology:

    • Y. lipolytica can be used to produce sufficient quantities of ATP synthase components for structural studies

    • The yeast's genome sequence reveals an accretion of genes and protein families involved in hydrophobic substrate utilization, which may influence membrane protein production

    • Heterologous expression systems in Y. lipolytica allow production of modified ATP6 variants for structure-function studies

  • Metabolic engineering:

    • Integration of ATP synthase engineering with Y. lipolytica's natural ability to produce valuable metabolites

    • Potential to enhance ATP production efficiency in biotechnological applications

    • Combination with the yeast's ability to grow on industrial and food waste substrates

  • Pharmaceutical research:

    • Development of screening systems for ATP synthase inhibitors

    • Production of ATP synthase components for drug development

    • Model system for mitochondrial disorders involving ATP synthase

Y. lipolytica's classification as GRAS (Generally Recognized as Safe) further supports its use in various research and potential biotechnological applications .

How do mutations in ATP6 affect ATP synthase assembly and function?

Mutations in ATP6 can have profound effects on ATP synthase assembly and function, with implications for both basic research and understanding mitochondrial disorders:

  • Effects on proton translocation:

    • Mutations in key residues forming the proton channel can alter proton conductance

    • Changes in conserved charged residues may disrupt the proton path through the membrane

    • Alterations in hydrophobic regions can affect membrane embedding and channel formation

  • Impacts on ATP synthase assembly:

    • Mutations may disrupt interactions with other F0 subunits, preventing proper complex formation

    • Structural alterations can affect the stability of the assembled complex

    • Some mutations may allow assembly but compromise function

  • Consequences for cellular bioenergetics:

    • Reduced ATP synthesis capacity

    • Altered mitochondrial membrane potential

    • Potential induction of mitochondrial dysfunction and associated cellular stress

  • Experimental approaches to study mutations:

    • Site-directed mutagenesis of recombinant ATP6

    • Expression in Y. lipolytica using the multi-copy integration system

    • Functional complementation assays in ATP6-deficient strains

    • Structural analysis of mutant proteins

While the search results don't provide specific mutation data for Y. lipolytica ATP6, the methodologies described for recombinant protein expression and multi-component system analysis provide valuable tools for investigating such mutations.

What spectroscopic methods are most effective for analyzing the structure of recombinant ATP6?

Given the membrane protein nature of ATP6, several specialized spectroscopic methods are particularly effective for structural analysis:

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information about secondary structure composition (α-helices, β-sheets)

    • Allows monitoring of thermal stability and conformational changes

    • Requires purified protein in detergent or lipid environments

  • Fourier-Transform Infrared Spectroscopy (FTIR):

    • Especially valuable for membrane proteins like ATP6

    • Analyzes secondary structure in membrane-mimetic environments

    • Can detect subtle conformational changes upon ligand binding

  • Nuclear Magnetic Resonance (NMR):

    • For specific labeled regions or fragments of ATP6

    • Provides atomic-level structural information

    • Can reveal dynamic properties and interactions with other molecules

  • Electron Paramagnetic Resonance (EPR) with Site-Directed Spin Labeling:

    • Analyzes specific residues and their environment

    • Provides information about residue mobility and accessibility

    • Can monitor conformational changes during protein function

  • Fluorescence Spectroscopy:

    • Using intrinsic tryptophan fluorescence or site-specific fluorescent labels

    • Provides information about local environment and conformational changes

    • Can be used to study protein-protein or protein-ligand interactions

The combination of these methods provides comprehensive structural information about ATP6, complementing higher-resolution techniques like X-ray crystallography or cryo-electron microscopy that may be challenging for membrane proteins.

What are the challenges in obtaining high-resolution structures of ATP6 and how can they be addressed?

Obtaining high-resolution structures of membrane proteins like ATP6 presents several significant challenges:

  • Expression and purification challenges:

    • Low natural abundance requires recombinant expression

    • Potential toxicity when overexpressed

    • Difficulty maintaining stability during purification

    Solutions:

    • Use of specialized expression systems like those described for Y. lipolytica

    • Expression with fusion partners to enhance stability

    • Careful optimization of detergent selection for extraction and purification

  • Crystallization difficulties:

    • Detergent micelles complicate crystal packing

    • Conformational heterogeneity reduces crystal quality

    • Hydrophobic surfaces limit crystal contacts

    Solutions:

    • Lipidic cubic phase crystallization

    • Antibody fragment co-crystallization to provide hydrophilic surfaces

    • Use of engineered, more stable variants

  • Cryo-EM challenges:

    • Small size of ATP6 alone makes particle alignment difficult

    • Preferential orientation in vitreous ice

    • Contrast issues with detergent or lipid backgrounds

    Solutions:

    • Study ATP6 as part of larger ATP synthase complex

    • Use of Volta phase plates to enhance contrast

    • Application of optimized grid preparation techniques

  • Functional state capture:

    • ATP6 may adopt different conformations during proton translocation

    • Capturing specific functional states for structural analysis is challenging

    Solutions:

    • Use of inhibitors or substrate analogs to trap specific states

    • Time-resolved structural methods for capturing intermediates

    • Computational modeling to predict conformational transitions

The combination of advanced expression systems like those developed for Y. lipolytica , careful biochemical characterization, and state-of-the-art structural biology techniques offers the best approach to overcoming these challenges.

What are the most common issues when working with recombinant ATP6 and how can they be resolved?

Researchers working with recombinant ATP6 typically encounter several challenges that require specific troubleshooting approaches:

  • Low expression yields:

    • Issue: Membrane proteins often express poorly due to toxicity or folding issues

    • Solution: Optimize expression conditions (temperature, inducer concentration, time); use specialized expression strains; consider fusion tags that enhance expression; for Y. lipolytica, implement multi-copy integration strategies

  • Protein aggregation:

    • Issue: Improper folding leading to inclusion body formation or aggregation

    • Solution: Express at lower temperatures; optimize detergent selection for solubilization; consider co-expression with chaperones; for storage, add 5-50% glycerol as indicated in protocols

  • Degradation during purification:

    • Issue: Proteolytic degradation during extraction and purification

    • Solution: Include protease inhibitors; minimize purification time; maintain low temperature throughout; consider optimization of purification buffers

  • Loss of activity:

    • Issue: Purified protein lacks functional activity

    • Solution: Verify proper folding using spectroscopic methods; optimize detergent or lipid environment; consider native purification approaches that maintain interactions with other subunits

  • Difficulties in reconstitution:

    • Issue: Challenges incorporating purified ATP6 into membranes or liposomes

    • Solution: Screen different lipid compositions; optimize protein-to-lipid ratios; consider gentle reconstitution methods like detergent dialysis

Table 3: Troubleshooting Matrix for Recombinant ATP6 Work

IssuePossible CausesDiagnostic ApproachSolutions
Low expressionToxicity, poor transcription, degradationWestern blot, RT-PCR, pulse-chaseAdjust expression conditions, change host, use fusion tags
AggregationImproper folding, detergent issuesSize exclusion chromatography, light scatteringLower expression temperature, screen detergents, add stabilizers
DegradationProteolysis, instabilityTime-course analysis by SDS-PAGEAdd protease inhibitors, reduce purification time, optimize buffers
InactivityDenaturation, missing cofactorsSpectroscopic analysis, binding assaysOptimize reconstitution, maintain native interactions, verify folding

What best practices should be followed for storage and handling of purified recombinant ATP6?

To maintain the stability and activity of purified recombinant ATP6, researchers should follow these evidence-based best practices:

  • Initial processing:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Stabilizing additives:

    • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

    • Consider alternative stabilizers for specific applications (e.g., sucrose, specific detergents)

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Create multiple small aliquots to avoid repeated freeze-thaw cycles

    • For short-term use, working aliquots can be stored at 4°C for up to one week

  • Buffer considerations:

    • Maintain protein in Tris/PBS-based buffer, pH 8.0, with 6% Trehalose

    • For specialized applications, screen buffers for optimal stability

  • Handling precautions:

    • Avoid repeated freeze-thaw cycles as this significantly reduces protein integrity

    • Always maintain the cold chain during experiments

    • Use appropriate detergents at concentrations above their critical micelle concentration

Following these guidelines ensures maximum retention of ATP6 structural integrity and functional activity, enhancing experimental reproducibility and reliability.

How is ATP6 research contributing to our understanding of mitochondrial diseases?

ATP6 research is advancing our understanding of mitochondrial diseases through several key approaches:

  • Pathogenic mutation modeling:

    • Recombinant expression systems allow recreation of disease-associated mutations

    • Y. lipolytica provides a eukaryotic context for studying mitochondrial protein function

    • Multi-component expression systems enable analysis of mutations in the context of assembled ATP synthase

  • Structure-function relationships:

    • Detailed structural studies of ATP6 help explain how specific mutations disrupt function

    • Biophysical characterization of mutant proteins reveals mechanisms of pathogenesis

    • Comparison of ATP6 across species identifies critical conserved regions implicated in disease

  • Therapeutic development platforms:

    • Recombinant expression systems provide platforms for screening potential therapeutics

    • Y. lipolytica, with its GRAS status and genetic accessibility, offers advantages for developing such platforms

    • High-throughput assays based on recombinant ATP6 can identify compounds that rescue mutant function

  • Mitochondrial energy metabolism insights:

    • Studies of ATP6 in the context of Y. lipolytica's robust mitochondrial system provide insights into energy metabolism adaptations

    • Understanding of compensatory mechanisms may reveal therapeutic targets

    • Y. lipolytica's ability to grow on various substrates enables studies of ATP synthase regulation under different metabolic conditions

These research directions highlight the importance of recombinant ATP6 systems in both fundamental research and translational applications related to mitochondrial diseases.

What are the future prospects for using engineered ATP6 variants in synthetic biology applications?

Engineered ATP6 variants hold promising potential for synthetic biology applications, particularly leveraging Y. lipolytica's unique characteristics:

  • Bioenergy applications:

    • Engineering ATP synthase components with enhanced efficiency

    • Development of artificial ATP-generating systems for biotechnological applications

    • Integration with Y. lipolytica's natural ability to grow on hydrophobic substrates

  • Biosensors development:

    • Creation of ATP6-based sensors for proton gradients or membrane potential

    • Development of screening systems for modulators of ATP synthase activity

    • Integration of sensing capabilities with Y. lipolytica's metabolic versatility

  • Synthetic cellular power systems:

    • Design of optimized cellular energy production modules

    • Engineering ATP synthase variants with altered ion specificity or regulation

    • Utilization of Y. lipolytica's multi-copy integration system for controlled expression

  • Biotechnological production platforms:

    • Enhancement of Y. lipolytica strains for recombinant protein production through optimized energy metabolism

    • Coupling improved ATP synthase function with the yeast's ability to produce valuable metabolites

    • Exploitation of Y. lipolytica's capacity to utilize waste substrates for sustainable bioprocesses

  • Biomimetic nanotechnology:

    • Development of ATP6-based nanomotors or molecular machines

    • Creation of artificial proton-gradient-driven systems

    • Incorporation into nanodevices for energy conversion

The advanced genetic tools available for Y. lipolytica, including the two-step approach for constructing recombinant strains with multiple expression cassettes , provide a powerful foundation for these synthetic biology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.