Recombinant Yarrowia lipolytica Chitobiosyldiphosphodolichol beta-mannosyltransferase (ALG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ALG1; YALI0E34133g; Chitobiosyldiphosphodolichol beta-mannosyltransferase; Asparagine-linked glycosylation protein 1; Beta-1,4-mannosyltransferase; GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase; GDP-mannose-dolichol diphosphochitobiose mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-463
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
ALG1
Target Protein Sequence
MKAWHWSVTLVVIYLAIPVILYLLTRKDDRKPLSDIRKRKRTIVLVLGDLGRSPRMLYHA RSLARSGHKVDLCGYDGAKPFDEILNNDLIKIHHIPLILNTRKLPFVVFGILKVIRQHWL LISLLYKLRGADYLLVQNPPSIPTLGVVRFYNLFLSTRTKVVLDWHNFGYTILALKLPET HPMVKFAKFYEGFFGGRAFVHLCVTVLMGQAMRKTFGMSGRRIVPLHDRPAFHFKPLSES EKLDVLRDFKETLYDDMTADHKIIVSSTSYTPDENFNILLDALALYDESKLDLPPLRVII TGKGPMMPEFLAKVEKLQLKRVSIRTAWLEFADYPRILGAAHLGVSLHESSSGYDLPMKV VDMFGCGIPVVSVDYAALSELVKTNTNGVAVKGHVEMGNTFMSLFSNRGKLDNIKRGAMI ESRNTWDQTWVKTVGPLFDIGEYVQQRPDEDYDFSSSSSDDDH
Uniprot No.

Target Background

Function
This protein participates in the formation of the lipid-linked precursor oligosaccharide essential for N-glycosylation. It is involved in assembling the dolichol-pyrophosphate-GlcNAc(2)-Man(5) intermediate on the cytoplasmic face of the endoplasmic reticulum (ER).
Database Links
Protein Families
Glycosyltransferase group 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of ALG1 beta-mannosyltransferase in glycosylation pathways?

The ALG1 gene encodes an enzyme critical to the glycosylation process, specifically functioning as a beta-1,4-mannosyltransferase. This enzyme catalyzes a crucial step in the formation of oligosaccharide chains by transferring mannose to growing oligosaccharides during the stepwise assembly of complex sugar chains. In the glycosylation pathway, ALG1 contributes to modifying proteins so they can fully perform their functions and modifies lipids to facilitate cell-cell interactions. The complete glycosylation process involves attaching these complex chains of sugar molecules (oligosaccharides) to proteins and lipids, which is essential for proper cellular function .

How do mutations in ALG1 affect glycosylation processes?

Mutations in the ALG1 gene typically result in the production of enzymes with severely reduced activity. These dysfunctional enzymes cannot efficiently add mannose to growing sugar chains, resulting in incomplete oligosaccharides. Although these shortened oligosaccharides can still be transferred to proteins and lipids, the process is significantly less efficient compared to the transfer of full-length oligosaccharides. This inefficiency leads to ALG1-congenital disorder of glycosylation (ALG1-CDG), characterized by intellectual disability, developmental delays, hypotonia, and various other symptoms affecting multiple body systems. The diverse clinical manifestations of ALG1-CDG likely result from impaired glycosylation of proteins and lipids essential for normal function across various organs and tissues .

What makes Yarrowia lipolytica suitable for heterologous protein expression?

Yarrowia lipolytica has emerged as a valuable host for heterologous protein expression due to several advantageous characteristics. The yeast offers a eukaryotic expression system that can perform post-translational modifications similar to those in higher eukaryotes. Y. lipolytica's genome allows for stable integration of multiple expression cassettes, facilitating the co-expression of several proteins simultaneously. The organism possesses strong promoters like the isocitrate lyase promoter (pICL1) that can drive high-level expression of heterologous proteins. Additionally, techniques have been developed for multi-copy integration using targeted sequences such as rDNA or the long terminal repeat (LTR) zeta of Ylt1, allowing for increased gene dosage and potentially higher protein yields .

What strategies enable successful multi-protein expression in Y. lipolytica systems?

Multi-protein expression in Y. lipolytica can be achieved through a systematic two-step approach that has been experimentally validated. The initial step involves constructing integrative multi-copy expression vectors containing the genes of interest under strong promoters. For optimal results, researchers should use vectors with appropriate integration targeting sequences (such as rDNA or LTR zeta of Ylt1) and multi-copy selection markers (such as ura3d4).

The process continues with simultaneous transformation of multiple expression vectors (up to three different vectors containing heterologous cDNAs) into haploid recipient strains. Subsequently, further combinations of expression cassettes can be incorporated through diploidisation using selected haploid multi-copy transformants. This methodology has successfully generated recombinant strains containing three to five different expression cassettes, as verified through Southern blotting analyses. The expression of the heterologous proteins can be confirmed using western blotting techniques .

How can researchers verify successful integration and expression of ALG1 in Y. lipolytica?

Verification of successful ALG1 integration and expression in Y. lipolytica requires a multi-faceted analytical approach:

  • Genomic Integration Confirmation:

    • Southern blotting provides definitive evidence of successful integration and copy number of expression cassettes

    • PCR-based verification can rapidly screen transformants for the presence of the integrated expression cassettes

  • Protein Expression Analysis:

    • Western blotting using antibodies specific to ALG1 or attached epitope tags confirms protein expression

    • SDS-PAGE with appropriate controls to evaluate protein size and expression levels

  • Functional Enzyme Activity:

    • Enzymatic assays measuring the transfer of mannose to appropriate oligosaccharide substrates

    • Analysis of glycosylation patterns in the recombinant strain versus control strains

These verification methods provide comprehensive evidence of both the genetic integration and functional expression of ALG1 in the Y. lipolytica system .

How do different integration targeting sequences affect ALG1 expression levels?

The choice of integration targeting sequences significantly impacts the expression level and stability of heterologous proteins like ALG1 in Y. lipolytica. Based on experimental evidence, two primary targeting sequences have demonstrated particular efficacy:

Integration TargetAdvantagesLimitationsCopy Number PotentialExpression Stability
rDNA sequencesHigh copy number potential, Homogeneous integrationMay cause growth defects at very high copy numbersUp to 200 copiesHighly stable across generations
LTR zeta of Ylt1Random integration allowing diverse expression levels, Lower metabolic burdenLess predictable expression levelsVariable (typically 1-30 copies)Moderately stable, may show position effects

The research indicates that vectors constructed using either rDNA or the LTR zeta of Ylt1 as integration targets, combined with the ura3d4 multi-copy selection marker, provide efficient systems for ALG1 expression. The selection of the appropriate targeting sequence should be based on the specific experimental requirements for expression level, stability, and cellular burden .

What promoter systems yield optimal expression of ALG1 in Y. lipolytica?

The selection of appropriate promoters is crucial for successful heterologous expression of enzymes like ALG1 in Y. lipolytica. Based on experimental data, the isocitrate lyase promoter (pICL1) has demonstrated particularly strong activity for driving the expression of mammalian proteins in Y. lipolytica. This promoter is inducible by growth on specific carbon sources and can achieve high expression levels under optimal conditions.

When designing expression systems for ALG1, researchers should consider the following promoter characteristics:

  • Strength: The pICL1 promoter provides robust expression levels suitable for complex enzymes

  • Regulation: Inducible promoters allow controlled expression, reducing potential toxicity

  • Compatibility: The promoter must function effectively with the gene of interest and not interfere with native cellular processes

For multi-component systems like those required for complete glycosylation pathways, using consistent promoters across expression cassettes may provide more balanced protein expression ratios .

How does diploidisation enhance heterologous protein expression in Y. lipolytica?

Diploidisation represents an advanced strategy for increasing the complexity and efficiency of heterologous protein expression in Y. lipolytica. This approach enables researchers to combine distinct sets of expression cassettes from different haploid strains into a single diploid strain, effectively doubling the genetic toolbox available for protein production.

The diploidisation process involves selecting haploid multi-copy transformants containing different expression cassettes and inducing their fusion to create diploid strains. This methodology has successfully generated recombinant strains harboring three to five different expression cassettes, significantly expanding the capacity for complex protein co-expression.

Key advantages of the diploidisation approach include:

  • Combining complementary expression cassettes without requiring additional transformation steps

  • Potential stabilization of expression through the diploid state

  • Creation of strains with balanced expression of multiple components of complex enzyme systems

  • Increased total gene dosage without additional selection pressure

This technique is particularly valuable for expressing multi-component systems like the P450scc system, where several proteins must function together in appropriate stoichiometric ratios .

What are the critical factors affecting ALG1 activity in heterologous expression systems?

The functional activity of recombinant ALG1 in Y. lipolytica depends on multiple factors beyond simple expression levels. The enzyme's beta-mannosyltransferase activity requires proper protein folding, membrane association, and access to appropriate substrates. Critical factors that researchers must consider include:

  • Post-translational modifications: Ensuring Y. lipolytica can perform necessary glycosylation, phosphorylation, or other modifications required for ALG1 function

  • Subcellular localization: Directing the enzyme to the appropriate cellular compartment (typically the endoplasmic reticulum membrane)

  • Substrate availability: Ensuring the host can synthesize or import chitobiosyldiphosphodolichol substrates

  • Cofactor requirements: Providing necessary metal ions or other cofactors required for enzymatic activity

  • Expression timing: Coordinating ALG1 expression with other enzymes in the glycosylation pathway

When designing experimental systems, these factors must be systematically addressed to achieve functional enzymatic activity rather than merely high expression levels .

How can researchers troubleshoot expression challenges with recombinant ALG1?

When encountering difficulties with ALG1 expression or activity in Y. lipolytica, a systematic troubleshooting approach is essential. The following methodological framework provides guidance for addressing common challenges:

ChallengePotential CausesMethodological SolutionsAnalytical Techniques
Low protein expressionCodon bias, Inefficient transcription, mRNA instabilityCodon optimization, Stronger promoter, Addition of introns or stabilizing elementsqPCR, Northern blotting, Ribosome profiling
Protein degradationProteolytic activity, Protein misfolding, ToxicityProtease-deficient strains, Lower growth temperature, Fusion tagsPulse-chase analysis, Western blotting with time course
Improper localizationMissing or defective signal sequencesAddition of ER targeting signals, Optimization of transmembrane domainsSubcellular fractionation, Fluorescent tagging
Inactive enzymeImproper folding, Missing cofactors, Incorrect glycosylationChaperone co-expression, Media supplementation, Expression of auxiliary glycosylation enzymesIn vitro activity assays, Structural analysis, Glycan profiling
Low copy numberInefficient integration, Selection pressure issuesAlternative integration sites, Increased selection marker deficiency, Multi-round transformationSouthern blotting, qPCR-based copy number analysis

This systematic approach allows researchers to identify specific bottlenecks in recombinant ALG1 expression and implement targeted solutions based on experimental evidence rather than trial-and-error methods .

How does Y. lipolytica compare to other expression systems for glycosylation enzymes?

When evaluating expression systems for glycosylation enzymes like ALG1, researchers must consider several factors including glycosylation capacity, expression levels, and ease of genetic manipulation. Y. lipolytica offers distinct advantages for expressing mammalian glycosylation enzymes compared to other commonly used systems.

Y. lipolytica's glycosylation machinery is more similar to mammalian systems than that of S. cerevisiae, potentially allowing for more native-like processing of mammalian glycosylation enzymes. The capacity for stable integration of multiple expression cassettes enables the reconstruction of complex glycosylation pathways requiring several enzymes working in concert.

The successful expression of steroidogenic mammalian proteins (P450scc system components) in Y. lipolytica demonstrates the system's versatility for heterologous protein expression. The methodology using integrative multi-copy expression vectors with different targeting sequences provides flexibility in optimizing expression levels for specific applications.

For complex glycosylation enzymes like ALG1, Y. lipolytica's ability to perform higher eukaryotic post-translational modifications may result in more properly folded and functional proteins compared to bacterial expression systems, while offering higher yields and easier genetic manipulation than mammalian cell culture systems .

What emerging technologies might enhance recombinant ALG1 expression in Y. lipolytica?

Emerging technologies show promise for significantly improving recombinant ALG1 expression and activity in Y. lipolytica systems. These advancements focus on genome engineering, expression optimization, and analytical techniques:

  • CRISPR-Cas9 genome editing: Enabling precise integration of expression cassettes at optimal genomic loci and modification of endogenous glycosylation pathways to support ALG1 function

  • Synthetic biology approaches: Development of standardized genetic parts optimized for Y. lipolytica, including promoters, terminators, and secretion signals specifically designed for glycosylation enzymes

  • Systems biology integration: Metabolic modeling to identify bottlenecks in substrate availability and optimize cell metabolism to support ALG1 activity

  • Advanced analytical methods: High-throughput glycan analysis and activity assays to rapidly quantify functional ALG1 activity rather than merely protein expression levels

  • Adaptive laboratory evolution: Directed evolution of Y. lipolytica strains for improved heterologous protein expression and folding capacity

These technologies collectively offer pathways to overcome current limitations in heterologous expression of complex glycosylation enzymes in yeast systems and advance our understanding of glycobiology through improved recombinant enzyme production .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.