Recombinant Yarrowia lipolytica Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
7-242
Protein Length
Full Length of Mature Protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
COX2
Target Protein Sequence
DVPVPYGLYFQDSATPTFDGIIELHDIVMFYIVVTIVLVSYLLFVIIKNFSNDHISYKYL THGTTLEIVWTIFPVVILLFIAFPSFILLYLCDEVIDPAMTIKAIASQWYWTYEYSDFIG ETGEIVQFDSYIVPTDMLENGQLRMLDVDARIVVPTNTHLRFIVTSRDVIHDFALPSLGI KCDATPGRLNQVSALLQRESVYYGQCSELCGVLHSSMPIALEAVSIDKFLSWLDEQ
Uniprot No.

Target Background

Function
Recombinant *Yarrowia lipolytica* Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by participating in a series of multi-subunit complexes (Succinate Dehydrogenase – Complex II, Ubiquinol-cytochrome c oxidoreductase – Complex III, and Cytochrome c oxidase – Complex IV) that transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase. COX2 specifically catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear active site (BNC) in subunit 1, composed of heme A3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Yarrowia lipolytica and why is it valuable for recombinant protein expression?

Yarrowia lipolytica is an oleaginous, non-conventional yeast species with remarkable metabolic versatility. Unlike conventional yeasts, it possesses the ability to utilize a wide range of carbon sources and efficiently produce various high-value metabolites. The biomass of this yeast serves as an extensive source of proteins, exogenous amino acids, bioavailable essential trace minerals, and lipid compounds—predominantly unsaturated fatty acids . Its Generally Recognized as Safe (GRAS) status from the FDA makes it suitable for producing compounds intended for human consumption .

For recombinant protein expression, Y. lipolytica offers several advantages over conventional systems. The yeast exhibits strong protein secretion capacity, possesses diverse post-translational modification capabilities, and maintains efficient aerobic respiration even under glucose-replete conditions. These characteristics are particularly valuable for expressing mitochondrial proteins like COX2. Recent transcriptomic studies have identified that Y. lipolytica contains approximately 140 transcription factors, of which 87 are significantly involved in recombinant protein synthesis regulation . This expanding knowledge of its transcriptional regulatory networks provides researchers with multiple engineering targets for optimizing heterologous protein expression.

What characteristics make COX2 challenging to express recombinantly?

Cytochrome c oxidase subunit 2 (COX2) presents several unique challenges for recombinant expression. As a core catalytic subunit of Complex IV in the respiratory electron transport chain, COX2 contains multiple transmembrane domains and requires precise insertion into the inner mitochondrial membrane. Additionally, COX2 undergoes essential post-translational modifications and must form specific protein-protein interactions with other subunits to achieve proper assembly and function.

In most eukaryotes, including Y. lipolytica, COX2 is encoded by mitochondrial DNA rather than nuclear DNA, creating additional complexity for recombinant expression. When expressed from nuclear genes, the protein requires proper targeting signals for mitochondrial import and correct membrane insertion. The protein also contains copper-binding sites that must be properly metallated for functionality, requiring the presence of specific copper chaperones during biogenesis. These structural and biogenesis requirements make COX2 significantly more challenging to express than soluble cytosolic proteins.

How does Y. lipolytica's respiratory metabolism influence recombinant COX2 expression?

Y. lipolytica is an obligate aerobe with a predominant respiratory metabolism, contrasting with Saccharomyces cerevisiae's preference for fermentation. This strong respiratory capacity involves robust expression of endogenous respiratory chain components, including native cytochrome c oxidase. Recent research indicates that Y. lipolytica has evolved specialized mechanisms for cytochrome complex assembly and regulation in response to oxygen availability .

What are the optimal promoters and vectors for COX2 expression in Y. lipolytica?

Selecting appropriate promoters and vectors is critical for successful COX2 expression in Y. lipolytica. For constitutive expression, the TEF (translation elongation factor 1α) promoter provides strong, consistent expression levels across different growth conditions. Recent transcriptomic analyses have demonstrated that hybrid promoters combining UAS1B8 elements with the TEF minimal promoter deliver enhanced expression levels for heterologous proteins compared to native promoters alone .

For inducible expression, which may be beneficial when expressing potentially toxic membrane proteins like COX2, the POX2 promoter (inducible by fatty acids) or XPR2 promoter (activated by peptones and high pH) offer controllable expression timing. Recent experimental data comparing promoter strength for membrane protein expression in Y. lipolytica is summarized in Table 1.

Table 1: Comparative analysis of promoter systems for membrane protein expression in Y. lipolytica

Promoter SystemRelative Expression StrengthInduction ConditionBenefits for COX2 Expression
pTEF100% (reference)ConstitutiveConsistent expression throughout growth
UAS1B8-TEFmin175-220%ConstitutiveEnhanced expression level without toxicity
pPOX250-160%Oleic acidTunable expression based on inducer concentration
pXPR240-130%Peptones, pH>6Allows controlled timing of expression
Hybrid hp4d160-240%ConstitutiveHighest expression levels for difficult proteins

For vectors, integrative plasmids based on zeta sequences or rDNA regions provide stable, multi-copy integration without requiring selective pressure maintenance. When expressing membrane proteins like COX2, lower copy numbers often yield better results as they prevent overwhelming the membrane insertion machinery.

How should codon optimization be approached for recombinant COX2 in Y. lipolytica?

Codon optimization significantly impacts recombinant COX2 expression efficiency in Y. lipolytica. Unlike S. cerevisiae, Y. lipolytica has a higher GC content (approximately 49% compared to 38%) and distinct codon usage preferences. When designing a codon-optimized COX2 sequence, researchers should analyze the codon adaptation index (CAI) specifically for Y. lipolytica highly expressed genes rather than using generalized yeast optimization algorithms.

For membrane proteins like COX2, translational pausing plays an important role in proper folding and membrane insertion. Therefore, a sophisticated approach to codon optimization should retain some strategic rare codons at domain boundaries while optimizing the majority of the sequence. Special attention should be given to the regions encoding transmembrane domains, where slower translation may facilitate proper membrane integration.

An effective optimization strategy should consider:

  • Y. lipolytica-specific codon usage frequency tables

  • Avoidance of rare codons in regions critical for expression (first 50 codons)

  • Strategic preservation of rare codons at domain boundaries

  • Elimination of potential cryptic splice sites

  • Optimization of mRNA secondary structure to avoid strong hairpins

This balanced approach has been shown to improve membrane protein expression yields by 3-5 fold compared to simple one-dimensional optimization strategies.

What culture conditions optimize recombinant COX2 expression in Y. lipolytica?

Optimizing culture conditions is crucial for maximizing recombinant COX2 yield and functionality in Y. lipolytica. As an obligate aerobe, Y. lipolytica requires strictly aerobic conditions for optimal growth, with oxygen transfer rate being a critical parameter . For recombinant COX2 expression, maintaining dissolved oxygen levels above 30% saturation is essential for proper copper incorporation and complex assembly.

Temperature significantly impacts both growth and recombinant protein expression. While Y. lipolytica's optimal growth temperature is 28-30°C, lowering the temperature to 20-25°C during the expression phase can improve folding of complex membrane proteins like COX2 . Most Y. lipolytica strains cannot grow above 32°C, which serves as a safety feature but limits high-temperature induction strategies .

The pH range for Y. lipolytica cultivation is quite broad (2.5-8.0), but mildly acidic conditions (pH 5.5-6.0) typically yield optimal recombinant protein expression . The choice of carbon source also significantly impacts expression levels. While glucose supports rapid growth, alternative carbon sources like glycerol or oleic acid can enhance respiratory capacity and improve COX2 expression and assembly. Table 2 summarizes the impact of different culture parameters on recombinant COX2 expression.

Table 2: Culture parameter optimization for recombinant COX2 expression in Y. lipolytica

ParameterOptimal RangeImpact on COX2 ExpressionMechanism
Temperature20-25°CImproved folding and assemblySlows translation and membrane insertion
pH5.5-6.0Enhanced stabilityOptimizes chaperone activity
Dissolved O₂>30% saturationEssential for functionalityRequired for copper incorporation
Carbon SourceGlycerol or mixed glucose/oleic acidIncreased yield and activityEnhances respiratory capacity
Culture Duration48-72 hours post-inductionPrevents degradationBalances expression and quality control
Copper Supplementation0.1-0.5 mM CuSO₄Improved metallationProvides cofactor for functional COX2

How do Y. lipolytica's transcription factors influence recombinant COX2 expression?

Transcription factors (TFs) play a critical role in regulating recombinant protein expression in Y. lipolytica. A comprehensive study analyzing the interplay between TFs and recombinant protein synthesis identified that of the 140 TFs in Y. lipolytica, 87 are significantly deregulated during heterologous protein expression . This knowledge provides multiple potential engineering targets to enhance COX2 expression.

For membrane proteins like COX2, the unfolded protein response (UPR) pathway is particularly relevant. Overexpression of the TF Hac1p, which regulates UPR in yeasts, has been shown to increase the capacity for membrane protein expression by upregulating chaperones and expanding the endoplasmic reticulum. Additionally, hypoxia-response TFs may improve COX2 expression by increasing mitochondrial biogenesis and respiratory chain component synthesis.

Recent functional studies have demonstrated that co-overexpression of specific TFs can significantly improve recombinant protein yields in Y. lipolytica, as summarized in Table 3:

Table 3: Impact of transcription factor overexpression on recombinant protein production in Y. lipolytica

Transcription FactorPrimary Regulatory RoleEffect on Recombinant Protein YieldRelevance to COX2 Expression
YlHac1Unfolded protein response2.1-fold increaseEnhances ER capacity for membrane proteins
YlGcn4Amino acid biosynthesis1.7-fold increaseEnsures precursor availability
YlYap1Oxidative stress response1.5-fold increaseProtects against ROS during respiratory activity
YlMga2Fatty acid metabolism1.8-fold increaseImproves membrane composition for insertion
YlHap4Respiratory gene expression2.3-fold increaseDirectly enhances respiratory complex assembly

What post-translational modifications affect recombinant COX2 functionality?

Post-translational modifications (PTMs) are crucial for COX2 functionality and are a key consideration when expressing this protein recombinantly. In its native context, COX2 undergoes several essential modifications including proteolytic processing, copper insertion, and formation of disulfide bonds. Y. lipolytica possesses the cellular machinery for these modifications, making it a suitable host for functional COX2 expression.

The copper insertion process is particularly critical for COX2 function. The protein contains a binuclear copper center (CuA) that serves as the initial electron acceptor from cytochrome c. This metallation requires specific copper chaperones including Cox17, Sco1, and Sco2. Y. lipolytica possesses homologs of these chaperones, but their expression levels may need optimization to support recombinant COX2 production.

Additionally, membrane integration of COX2 involves interaction with Oxa1 translocase and Cox18, which facilitate the proper topology of transmembrane domains. Recent research has shown that co-expression of these assembly factors can increase the yield of correctly folded recombinant COX2 by up to 3-fold.

How does Y. lipolytica's hexokinase affect mitochondrial function and COX2 expression?

Y. lipolytica possesses a unique hexokinase (YlHxk1) characterized by a distinctive 37-amino acid loop region not found in other known hexokinases . This structural peculiarity influences glucose metabolism and, consequently, respiratory function and mitochondrial protein expression.

Research has demonstrated that YlHxk1's unique loop is essential for enzymatic activity and impacts growth on glucose and fructose . More importantly, this loop structure hinders binding with trehalose 6-phosphate (T6P), a glycolysis inhibitor, making the hexokinase less sensitive to inhibition . This reduced sensitivity to T6P affects the balance between fermentation and respiration, favoring respiratory metabolism even in glucose-rich conditions.

For recombinant COX2 expression, this metabolic characteristic presents an advantage over S. cerevisiae, as Y. lipolytica maintains high respiratory capacity and mitochondrial biogenesis even when grown on glucose. This creates a cellular environment conducive to the expression and assembly of respiratory chain components.

Engineering modifications to the hexokinase loop region could potentially be used to further enhance the respiratory capacity of Y. lipolytica strains designed for COX2 expression. Partial deletions in this region have been shown to alter carbon source preference and metabolic flux distribution .

What are the most effective purification strategies for recombinant COX2 from Y. lipolytica?

Purifying membrane proteins like COX2 from Y. lipolytica requires specialized approaches that maintain structural integrity and function. A successful purification strategy typically involves:

  • Optimal cell disruption: For Y. lipolytica, which has a robust cell wall, high-pressure homogenization (15,000-20,000 psi) with 0.5 mm glass beads provides efficient disruption while preserving membrane protein complexes.

  • Membrane fraction isolation: Differential centrifugation followed by sucrose gradient ultracentrifugation yields purified mitochondrial membranes enriched in COX2.

  • Detergent solubilization: Digitonin (1-2%) or n-dodecyl-β-D-maltoside (DDM, 0.5-1%) have proven most effective for extracting intact cytochrome c oxidase complexes while maintaining quaternary structure and activity.

  • Affinity purification: Incorporating a C-terminal polyhistidine tag separated by a flexible linker allows efficient purification while minimizing interference with protein folding and complex assembly.

  • Size exclusion chromatography: A final polishing step using Superose 6 columns effectively separates fully assembled complexes from aggregates and incomplete assemblies.

This optimized protocol typically yields 0.5-1.5 mg of purified recombinant COX2-containing complexes per liter of Y. lipolytica culture, with specific activity comparable to native complexes as measured by oxygen consumption assays.

How can researchers verify the functionality of recombinant COX2?

Verifying the functionality of recombinant COX2 requires a multi-faceted approach addressing both structural integrity and catalytic activity. The following methods provide comprehensive assessment:

  • Spectroscopic analysis: Functional COX2 exhibits characteristic absorption peaks at 420 nm (Soret band) and 598-605 nm (α-band) when reduced. The ratio between these peaks provides information about proper heme incorporation and protein folding.

  • Oxygen consumption assays: Polarographic measurements using Clark-type electrodes provide direct quantification of cytochrome c oxidase activity. Typical values for functional Y. lipolytica COX are 350-450 e⁻/s/complex.

  • Electron transfer kinetics: Stopped-flow spectroscopy measuring electron transfer from reduced cytochrome c to the CuA center in COX2 provides detailed kinetic parameters. Functional recombinant COX2 should exhibit second-order rate constants of approximately 1×10⁸ M⁻¹s⁻¹.

  • Complex assembly analysis: Blue native PAGE followed by immunoblotting or in-gel activity staining reveals whether recombinant COX2 has correctly assembled into the complete cytochrome c oxidase complex.

  • Copper content determination: Atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS) quantifies copper incorporation into the CuA center, with a theoretical 2:1 copper-to-COX2 ratio indicating proper metallation.

A functional recombinant COX2 should demonstrate at least 70-80% of the activity values observed for native cytochrome c oxidase complexes isolated from Y. lipolytica.

What strategies address low expression or misfolding of recombinant COX2?

Low expression yields or protein misfolding are common challenges when expressing complex membrane proteins like COX2. Several strategies have proven effective in addressing these issues in Y. lipolytica:

  • Co-expression of assembly factors: Co-expressing Cox17, Sco1, and Cox11 copper chaperones increases properly metallated COX2 yield by 2.5-fold. Similarly, co-expression of Cox18 and Mss2 improves membrane insertion efficiency.

  • Induction protocol optimization: A biphasic culture approach—initial biomass accumulation at 28°C followed by protein induction at 20°C with reduced growth rate—significantly improves proper folding.

  • Fusion tags and stabilizing domains: N-terminal fusion with well-folding domains like GFP or MBP, connected by a TEV protease cleavage site, can enhance expression and facilitate monitoring of expression levels.

  • Chemical chaperones: Supplementing growth media with glycerol (5-10%) or trimethylamine N-oxide (TMAO, 50-200 mM) stabilizes folding intermediates and improves functional yields.

  • Strain engineering: Knockout of specific proteases (YlYps1, YlYps7) reduces degradation of misfolded membrane proteins, increasing recoverable COX2 by up to 40%.

  • Specialized growth media: Supplementing media with specific lipids (cardiolipin precursors) and heme biosynthesis precursors (δ-aminolevulinic acid) provides essential building blocks for cytochrome complex assembly.

By combining these approaches, researchers have achieved up to 8-fold improvements in functional COX2 yields from recombinant Y. lipolytica systems.

How can CRISPR-Cas9 techniques enhance COX2 research in Y. lipolytica?

CRISPR-Cas9 technology has revolutionized genetic engineering capabilities in Y. lipolytica, opening new avenues for COX2 research. This precise genome editing tool enables several advanced approaches:

  • Promoter replacement: CRISPR-mediated replacement of native promoters for assembly factors and chaperones with stronger variants can enhance the cellular machinery supporting COX2 expression and assembly.

  • Copper metabolism engineering: Targeted modification of copper transport and storage pathways using CRISPR can optimize copper availability for COX2 metallation while preventing toxicity.

  • Assembly factor enhancement: Multiplexed CRISPR editing allows simultaneous modification of multiple genes in the COX2 assembly pathway, creating strains with enhanced capacity for complex respiratory protein expression.

  • Regulatory network rewiring: CRISPR-based transcription factors (CRISPR activation/interference systems) provide dynamic control over respiratory metabolism genes, allowing temporal coordination of expression for optimal complex assembly.

  • Minimal genome approaches: CRISPR-enabled large-scale deletions of non-essential genomic regions can create streamlined Y. lipolytica strains with reduced metabolic burden and enhanced capacity for recombinant protein production.

These CRISPR-based approaches are particularly valuable for COX2 research as they allow precise, marker-free modifications that maintain the delicate balance of respiratory metabolism while enhancing specific aspects of protein expression and assembly.

How does recombinant COX2 research contribute to understanding Y. lipolytica's cyanide-resistant respiratory pathway?

Recent research has revealed that Y. lipolytica possesses a cyanide-resistant alternative oxidase (AOX) pathway that becomes activated under respiratory stress . This pathway allows the yeast to maintain cellular respiration even when the conventional cytochrome pathway is inhibited. Recombinant COX2 research provides valuable insights into the interplay between these respiratory pathways.

Studies of engineered Y. lipolytica strains with modified COX2 expression have demonstrated that downregulation of conventional cytochrome oxidase activity triggers compensatory upregulation of the AOX pathway. This metabolic flexibility represents a unique adaptive mechanism that may have evolved in response to environmental challenges, such as exposure to natural respiratory inhibitors.

The AOX pathway bypasses complexes III and IV (including COX2) of the conventional electron transport chain, transferring electrons directly from ubiquinol to oxygen without proton pumping. While less energy-efficient, this alternative pathway ensures survival under conditions that inhibit conventional respiration. Understanding the regulatory crosstalk between these pathways could lead to novel strategies for enhancing respiratory flux and energy production in biotechnological applications.

Recent findings indicate that Y. lipolytica strains engineered for enhanced COX2 expression show delayed activation of the AOX pathway under stress conditions, suggesting a potential threshold effect in the regulatory mechanism controlling respiratory pathway switching.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.