Recombinant Yarrowia lipolytica Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Y. lipolytica COX3 is a full-length, His-tagged protein (268 amino acids; UniProt ID: Q9B6D8) expressed in Escherichia coli . It is derived from the mitochondrial cytochrome c oxidase complex (Complex IV), which catalyzes the final step of the electron transport chain. Key production details include:

ParameterSpecification
Host OrganismYarrowia lipolytica (strain CLIB 122/E150)
Expression SystemE. coli
TagN-terminal 10×His tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C; Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water (0.1–1.0 mg/mL) with optional glycerol for long-term storage

Amino Acid Sequence

The protein sequence begins with MNLTLKKFQV... and includes transmembrane domains critical for its role in proton translocation and electron transfer .

Biochemical Properties

  • Molecular Function: Integral subunit of Complex IV, facilitating oxygen reduction to water and proton gradient generation .

  • Stability: Sensitive to repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Comparative Analysis with Related Proteins

ProteinCOX3 (This Study)Coa3 (Assembly Protein)
GeneCOX3COA3 (Q6CHT7)
Length268 aa106 aa
FunctionElectron transportCytochrome oxidase assembly
Expression HostE. coliE. coli
TagHis tagHis tag

Source: Comparative data inferred from homologous proteins in Y. lipolytica .

Industrial and Metabolic Engineering Context

  • Lipid Metabolism: Y. lipolytica strains engineered for fatty acid overproduction often require robust mitochondrial activity, where COX3 plays a role .

  • Recombinant Protein Systems: Y. lipolytica outperforms P. pastoris in biomass and extracellular enzyme yields under optimized conditions, highlighting its suitability for COX3 production .

Challenges and Future Directions

  • Functional Studies: Limited in vivo data on COX3-specific interactions or knockouts in Y. lipolytica.

  • Biophysical Characterization: High-resolution structural data (e.g., cryo-EM) could elucidate its role in Complex IV assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes section, and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery time estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please let us know, and we will prioritize developing the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
COX3
Target Protein Sequence
MNLTLKKFQVHPFHLVAPSPWPILVSFSVMSIMLTLVFNMHGFMHNNYWVVFSAIVAIMT MALWFRDIISEATYLGDHTLAVRKGLNIGFILFVVSELFFFIAIFWAFFHSAMAPTIELG GVWPPVGIEAIGPSELPLLNTILLLCSGATLTWSHHALLGGNRFNTLLGLILTIALAVTF MICQYMEYSNAPFTISDGIFGSVFYFGTGFHGLHIIIGIIMLGVSLWRIYTYQLTNNHHV GYETSILYYHFVDVVWLFLYIVFYWWGT
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a crucial component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient powers transmembrane transport and the ATP synthase. Cytochrome c oxidase specifically catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Yarrowia lipolytica Cytochrome c Oxidase Subunit 3?

Yarrowia lipolytica Cytochrome c Oxidase Subunit 3 (COX3) is a fundamental component of the mitochondrial respiratory chain in this oleaginous yeast. It is encoded by the COX3 gene and functions as part of Complex IV (cytochrome c oxidase) in the electron transport chain. The protein consists of 268 amino acids and plays a critical role in cellular respiration . COX3 contributes to the binding of molecular oxygen to the cytochrome complex, which is essential for oxidative phosphorylation and ATP production within the cell .

How does COX3 relate to Yarrowia lipolytica's unique respiratory capabilities?

Yarrowia lipolytica possesses distinctive respiratory capabilities that set it apart from conventional yeasts, particularly its cyanide-resistant respiratory pathway. COX3 plays a significant role in the standard cytochrome pathway, but Y. lipolytica notably features an alternative oxidase (AOX) system that provides a cyanide-resistant respiratory route . This dual respiratory system allows Y. lipolytica to maintain cellular respiration even under conditions that would inhibit conventional respiratory chains.

The relationship between COX3 and the AOX pathway becomes evident when examining the organism's response to metabolic stress. Transcriptome analysis reveals that under certain conditions, Y. lipolytica overexpresses genes that promote the binding of molecular oxygen to the cytochrome iv complex, which includes COX3 . This upregulation represents part of the organism's strategy to enhance oxidative phosphorylation, optimize ATP production, and sustain cellular function under metabolic burden. The interplay between these respiratory systems contributes to Y. lipolytica's metabolic flexibility and resilience, allowing it to thrive in diverse environmental conditions.

How is recombinant COX3 typically produced for research purposes?

Recombinant Y. lipolytica COX3 protein is typically produced using heterologous expression systems, with E. coli being a common host for this purpose . The full-length protein (1-268 amino acids) is often tagged, with histidine tags (His-tag) being particularly useful for purification purposes. The recombinant protein is expressed from a construct containing the COX3 gene sequence optimized for expression in the host organism.

The expression process involves transforming a suitable E. coli strain with the recombinant expression vector, inducing protein expression, and then harvesting and lysing the cells to release the recombinant protein. The His-tagged COX3 protein is then purified using affinity chromatography, typically with nickel or cobalt resins that bind specifically to the His-tag. After purification, the protein is often lyophilized for storage stability and can be reconstituted in an appropriate buffer when needed for experimental use . The reconstitution process typically involves adding deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (typically 5-50% final concentration) for long-term storage at -20°C or -80°C to prevent freeze-thaw damage.

What are the optimal storage conditions for recombinant Y. lipolytica COX3?

Proper storage of recombinant Y. lipolytica COX3 is crucial for maintaining its structural integrity and functional activity. The purified protein is typically provided as a lyophilized powder, which should be briefly centrifuged before opening to ensure all material is at the bottom of the vial . For long-term storage, the recommended practice involves reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding glycerol to a final concentration of 5-50% (with 50% being the default in many protocols), and storing aliquots at -20°C or preferably -80°C .

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. For working stocks, aliquots can be stored at 4°C for up to one week. The protein is typically stored in a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose, which helps maintain protein stability during freeze-thaw cycles . Before using stored protein for experiments, it's advisable to centrifuge the protein solution briefly to remove any potential aggregates and verify protein concentration and activity.

What functional assays can be used to characterize recombinant COX3 activity?

Characterizing the functional activity of recombinant Y. lipolytica COX3 involves several specialized assays that assess its role in respiratory processes. Cytochrome c oxidase activity assays typically measure the rate of cytochrome c oxidation spectrophotometrically by monitoring the decrease in absorbance at 550 nm as reduced cytochrome c is oxidized. When working specifically with COX3, researchers must consider that it functions as part of the larger cytochrome c oxidase complex, so reconstitution with other subunits may be necessary for full functional assessment.

Oxygen consumption assays using oxygen electrodes or optical sensors provide direct measurement of respiratory activity. These assays can be performed with isolated mitochondria, membrane preparations, or reconstituted systems containing recombinant COX3. For investigating COX3's role in the cyanide-resistant respiratory pathway, comparative assays in the presence and absence of cyanide inhibitors help differentiate between the standard cytochrome pathway and the alternative oxidase (AOX) pathway .

Additionally, binding assays using labeled ligands or surface plasmon resonance can assess COX3's interaction with other respiratory complex subunits or regulatory molecules. These functional characterizations are essential for understanding how mutations or modifications affect COX3's contribution to respiratory processes and can provide insights into the structural basis of its function.

How can researchers troubleshoot low expression yields of recombinant COX3?

Low expression yields of recombinant Y. lipolytica COX3 can result from multiple factors related to its highly hydrophobic nature and membrane protein characteristics. To troubleshoot this common challenge, researchers should first optimize codon usage in the expression construct for the host organism, as suboptimal codons can significantly reduce translation efficiency. Expression vectors with strong, inducible promoters specifically designed for membrane proteins (like pET-based systems with T7 promoters for E. coli) often provide better control over expression levels.

The choice of expression host is crucial - while E. coli is commonly used , alternative hosts like Pichia pastoris or even cell-free systems might yield better results for membrane proteins like COX3. Expression conditions should be carefully optimized, typically using lower induction temperatures (16-20°C) and longer expression times to allow proper folding of the membrane protein. Adding specific compounds to the culture medium, such as glycerol, specific detergents, or molecular chaperone co-expression, can also enhance proper folding and stability.

Purification protocols may need modification to include specialized detergents suitable for membrane proteins, ensuring efficient extraction from the membrane while maintaining native structure. Screening different detergents (e.g., DDM, LDAO, or Fos-choline) at various stages of purification can improve yields. Finally, considering fusion partners beyond the standard His-tag, such as MBP (maltose-binding protein) or SUMO, can enhance solubility and expression levels of recombinant COX3.

How does Y. lipolytica COX3 contribute to cyanide-resistant respiration?

Research indicates that strains with enhanced metabolic activity in cyanide-rich environments show significant changes in gene expression patterns related to respiratory complexes. These strains overexpress genes that promote the binding of molecular oxygen to the cytochrome iv complex, which includes COX3 . This suggests that while AOX provides the cyanide-resistant route, the regulation and expression of conventional respiratory components like COX3 are adaptively modulated to maintain cellular homeostasis.

Mitochondria-related transcriptome analysis of engineered Y. lipolytica strains reveals that the cyanide-resistant respiratory pathway activation coincides with changes in COX3-related gene expression patterns, indicating a coordinated response mechanism . This adaptation allows the organism to enhance oxidative phosphorylation, optimize ATP production, and sustain cellular function even under toxic conditions. Understanding the regulatory mechanisms between these pathways provides insights into metabolic engineering strategies for biotechnological applications.

What role does COX3 play in metabolic engineering applications of Y. lipolytica?

COX3's function in Y. lipolytica's respiratory flexibility makes it a significant consideration in metabolic engineering applications. Researchers working with engineered Y. lipolytica strains have observed that modifications affecting respiratory pathways can significantly impact the organism's metabolic output, particularly in relation to lipid production and carbon utilization . In engineered strains designed for cyanogenic glycoside detoxification, the expression of heterologous enzymes led to reduced lipid production compared to wild-type strains, correlating with changes in respiratory pathway gene expression .

The modified respiratory activity in engineered strains affects the citric acid cycle dynamics, which in turn influences fatty acid synthesis. Specifically, engineered strains showed lower citrate accumulation despite overexpression of citrate synthase, suggesting a metabolic shift prioritizing energy generation over lipid production . This metabolic reprogramming demonstrates how respiratory pathway components, including COX3, are integrated into the broader metabolic network.

For researchers developing Y. lipolytica strains for specific biotechnological applications, understanding how genetic modifications affect COX3 expression and function can help predict and optimize metabolic outcomes. Strategies might include targeted expression modulation of respiratory components to balance growth, substrate utilization, and product formation. Additionally, the cyanide-resistant respiratory capabilities facilitated by the interplay between conventional and alternative pathways can be leveraged for applications involving toxic substrates or challenging environmental conditions.

How does Y. lipolytica COX3 compare structurally and functionally to COX3 from other organisms?

Unlike the COX3 from conventional yeasts like Saccharomyces cerevisiae, Y. lipolytica COX3 functions within a respiratory system that includes a robust alternative oxidase pathway. This dual respiratory capability suggests potential structural or regulatory adaptations in Y. lipolytica's respiratory components, including COX3, that facilitate efficient switching between pathways or simultaneous operation under certain conditions .

The expression of Y. lipolytica COX3 appears to be coordinated with the regulation of other respiratory components in response to metabolic challenges, such as exposure to respiratory inhibitors or expression of heterologous proteins. Transcriptome analyses have shown that under conditions that activate the cyanide-resistant respiratory pathway, genes related to cytochrome complexes undergo expression changes that may reflect adaptive responses . These regulatory patterns might differ from those observed in organisms lacking alternative respiratory pathways, representing an evolutionary adaptation to Y. lipolytica's ecological niche and metabolic lifestyle.

How can recombinant COX3 be used to study Y. lipolytica's alternative substrate metabolism?

Recombinant COX3 provides a valuable tool for investigating Y. lipolytica's remarkable ability to metabolize alternative substrates. This non-conventional yeast can utilize various carbon sources, including hexose and pentose sugars, glycerol, lipids, and acetate . Studies indicate that the respiratory pathways, including components like COX3, play crucial roles in the efficient utilization of these diverse substrates. By using purified recombinant COX3 in reconstitution experiments, researchers can assess how this protein's function varies when cells are grown on different carbon sources.

Particularly interesting is Y. lipolytica's cryptic metabolism of xylose, which becomes active under specific conditions or through metabolic engineering . Investigations using recombinant COX3 can help elucidate how respiratory chain adaptations support growth on alternative substrates like xylose. Experimental approaches might include comparative proteomic analysis of respiratory complexes isolated from cells grown on different carbon sources, with recombinant COX3 serving as a standard for quantification and functional comparisons.

Additionally, site-directed mutagenesis of recombinant COX3 can help identify specific amino acid residues critical for respiratory function under various substrate conditions. Such structure-function analyses provide insights into the molecular basis of Y. lipolytica's metabolic flexibility, potentially informing engineering strategies to enhance alternative substrate utilization for biotechnological applications.

What emerging technologies are advancing COX3 research in Y. lipolytica?

Research on Y. lipolytica COX3 is benefiting from several emerging technologies that provide unprecedented insights into its structure, function, and regulation. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, enabling high-resolution structural determination of respiratory complexes without the need for crystallization. Applied to Y. lipolytica respiratory complexes, cryo-EM can reveal detailed structural information about COX3's integration within the cytochrome c oxidase complex and its potential structural adaptations related to alternative respiration.

Advanced genetic engineering tools specifically developed for Y. lipolytica, including CRISPR-Cas9 systems and synthetic biology approaches, allow precise modification of COX3 and related genes to study their functions. These technologies facilitate the creation of reporter strains with tagged COX3 for in vivo localization and dynamic studies, as well as strains with tunable expression systems for dosage-effect investigations.

Multi-omics approaches integrating transcriptomics, proteomics, and metabolomics provide comprehensive views of how COX3 expression and function correlate with global metabolic patterns under various conditions. For instance, studies on engineered Y. lipolytica strains have shown how expression of heterologous proteins affects respiratory pathways and consequently alters lipid metabolism . These integrated analyses reveal the broader metabolic context of COX3 function, essential for understanding its role in Y. lipolytica's metabolic versatility.

How can COX3 research contribute to developing Y. lipolytica as a biotechnological platform?

Research on Y. lipolytica COX3 and its role in respiratory flexibility directly contributes to developing this organism as a robust biotechnological platform. Understanding the function of COX3 in both conventional and alternative respiratory pathways provides insights for engineering strains with enhanced metabolic capabilities. For instance, knowledge of how respiratory pathways affect energy metabolism can inform strategies to balance growth and product formation in industrial applications.

Y. lipolytica's ability to grow on alternative substrates makes it attractive for bioconversion processes using renewable feedstocks. Studies have shown that engineered strains of Y. lipolytica can efficiently utilize xylose when key pathway genes are overexpressed . Understanding how respiratory components like COX3 support growth on these alternative substrates can guide further engineering to improve substrate utilization efficiency and product yields.

Recent research demonstrates that engineered Y. lipolytica strains can be developed for specific applications such as detoxification of cyanogenic glycosides in food plants . These applications rely on the organism's metabolic resilience, which is partly attributed to its respiratory flexibility involving both cytochrome and alternative oxidase pathways. By characterizing how COX3 functions within this respiratory network, researchers can develop strains with enhanced tolerance to toxic compounds or metabolic burdens, expanding the range of potential biotechnological applications for Y. lipolytica.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.