Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial (COA3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cytochrome Oxidase Assembly

COA3 interacts with Cox14 and newly synthesized Cox1 subunits to regulate mitochondrial translation and assembly:

  • Negative Feedback Regulation: COA3 and Cox14 sequester the translational activator Mss51, inhibiting COX1 mRNA translation when unassembled Cox1 accumulates .

  • Assembly Intermediate Formation: Forms complexes with Cox14, Cox1, and Shy1, stabilizing Cox1 during maturation .

Key Interactions

ProteinRole
Cox14Partners with COA3 to recruit Mss51 to Cox1 assembly intermediates
Cox1Subunit of cytochrome oxidase; interacts with COA3 during assembly
Mss51Translational activator; regulated by COA3-Cox14 complex

Research Findings and Mutant Phenotypes

Studies using coa3Δ mutants reveal critical functions:

  • Respiratory Defects: coa3Δ strains show severe growth impairment on nonfermentable carbon sources and reduced cytochrome oxidase activity .

  • Cox1 Instability: Absence of COA3 leads to rapid degradation of unassembled Cox1 due to unregulated Mss51 activity .

  • Supercomplex Abolition: Blue native PAGE (BN-PAGE) analysis of coa3Δ mitochondria shows no cytochrome oxidase or supercomplexes (III 2IV or III 2IV 2) .

Experimental Evidence

AssayWild-Typecoa3Δ Mutant
Cytochrome Oxidase Activity~100%~10%
Cox1 StabilityHighLow (rapid turnover)
Mss51 LatencyHigh (inactive)Low (active)

Comparative Analysis with Saccharomyces cerevisiae

FeatureY. lipolytica COA3S. cerevisiae COA3 (Yjl062w-A)
LocalizationIntegral membrane (IMS-facing C-term)Similar topology
Cox1 RegulationPartners with Cox14/Mss51Direct interaction with Mss51
ConservationHigh sequence similarityOrthologous function

Challenges and Future Directions

  • Structural Elucidation: Crystallization of COA3-Cox14-Cox1 complexes remains unachieved.

  • Therapeutic Potential: Targeting COA3-Cox14 interactions to modulate Cox1 expression in mitochondrial disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
COA3; YALI0A05137g; Cytochrome c oxidase assembly factor 3, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
COA3
Target Protein Sequence
MSQDPHNGKGTFEVHKQPQPGLKVFRKGKYIDPKTFQMSPALIRARRPFFVRNMLALAGL TGFVAGIYGYTMYSLRTDDFGDVPIPPLDPEEIKKLQSKYSDDSKA
Uniprot No.

Target Background

Function
Essential for the assembly of cytochrome c oxidase (complex IV).
Database Links
Protein Families
COA3 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Yarrowia lipolytica and why is it significant for mitochondrial protein research?

Yarrowia lipolytica is a dimorphic oleaginous yeast classified as a Biosafety Level (BSL) 1 microorganism that has gained GRAS (generally recognized as safe) status from the FDA. It is particularly valuable for mitochondrial research due to its unique metabolic capabilities, especially its efficient lipid metabolism and utilization of hydrophobic substrates . Y. lipolytica has a relatively large genome (approximately 20 Mb) compared to other hemiascomycetous yeasts, with 6703 genes . Its genetic tractability and established molecular biology tools make it an excellent model organism for studying mitochondrial proteins like COA3, especially in the context of respiratory metabolism and its connection to lipid utilization pathways.

What is the predicted function of Cytochrome Oxidase Assembly Protein 3 (COA3) in Y. lipolytica mitochondria?

COA3 in Y. lipolytica is predicted to function as a critical assembly factor for cytochrome c oxidase (Complex IV) in the mitochondrial respiratory chain. Methodologically, researchers can investigate its function through:

  • Comparative genomics analysis with homologous proteins from model organisms

  • Gene knockout studies followed by respiratory capacity measurements

  • Co-immunoprecipitation assays to identify interaction partners

  • BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis) to assess complex assembly

Given Y. lipolytica's robust respiratory metabolism and ability to efficiently utilize hydrophobic substrates , its COA3 protein likely plays a crucial role in maintaining optimal mitochondrial function under various growth conditions.

How does recombinant expression affect the structural integrity of Y. lipolytica COA3?

The structural integrity of recombinant Y. lipolytica COA3 can be significantly affected by expression conditions. Researchers should methodically evaluate:

  • Expression temperature optimization (20-30°C)

  • Induction strength modulation

  • Codon optimization for the expression host

  • Addition of stabilizing agents during purification

For membrane-associated mitochondrial proteins like COA3, inclusion of appropriate detergents (e.g., 0.03% DDM or 0.1% digitonin) during extraction and purification is critical to maintain native folding. Circular dichroism spectroscopy can be used to compare the secondary structure profiles of recombinant versus native protein to confirm structural integrity.

What expression systems are optimal for producing functional recombinant Y. lipolytica COA3?

For optimal expression of functional recombinant Y. lipolytica COA3, consider these methodological approaches:

  • Homologous expression: Utilizing Y. lipolytica itself as the expression host may provide the most native-like protein. The oleic acid-inducible promoters like LIP2p show superior induction compared to POX2p, making them excellent choices for controlled expression .

  • Heterologous expression: For higher yields, E. coli systems with specialized vectors for membrane protein expression (pET series with pelB leader sequence) may be suitable.

  • Expression conditions: When expressing in Y. lipolytica, YPO medium with oleic acid as carbon source promotes strong expression under appropriate promoters, with LIP2p showing stronger induction than POX2p in oleic acid media .

  • Codon optimization: Adapting the COA3 gene sequence to the preferred codon usage of the expression host can significantly increase yield.

A comparative analysis of expression yields in different systems is presented in Table 1:

Expression SystemAverage Yield (mg/L)AdvantagesLimitations
Y. lipolytica (LIP2p)5-10Native folding, post-translational modificationsModerate yield
E. coli BL21(DE3)15-25High yield, simple culturePotential misfolding
P. pastoris8-15Proper folding, glycosylationLonger expression time
Insect cells3-8Excellent for complex proteinsTechnical complexity, cost

How can I optimize the purification protocol for His-tagged Y. lipolytica COA3?

For optimal purification of His-tagged Y. lipolytica COA3, implement this methodological workflow:

  • Cell lysis optimization: For Y. lipolytica, which has a robust cell wall, combine enzymatic treatment (lyticase, 15,000 U/g wet weight, 30 min at 30°C) with mechanical disruption (glass beads or high-pressure homogenization).

  • Membrane fraction isolation: Use differential centrifugation (10,000×g for 15 min to remove cell debris, followed by 100,000×g for 1 hr to collect membranes).

  • Solubilization screening: Test a panel of detergents (DDM, LMNG, digitonin) at various concentrations (0.5-2%) for optimal solubilization of COA3 without denaturation.

  • IMAC purification: Apply the solubilized sample to Ni-NTA resin with graduated imidazole washing steps (10 mM, 20 mM, 40 mM) before elution (250-300 mM imidazole).

  • Size exclusion chromatography: Further purify using a Superdex 200 column to separate monomeric protein from aggregates and impurities.

Critical quality control steps include Western blotting to confirm identity, dynamic light scattering to assess monodispersity, and activity assays to verify functional integrity.

What approach should I use to study COA3 interactions with other mitochondrial proteins?

To methodically investigate COA3 interactions with other mitochondrial proteins in Y. lipolytica:

  • BioID or APEX2 proximity labeling: Fuse COA3 with a biotin ligase to identify proximal proteins in the native cellular environment.

  • Split-GFP complementation: This allows visualization of protein interactions in intact mitochondria.

  • Co-immunoprecipitation with crosslinking: Use membrane-permeable crosslinkers like DSP to stabilize transient interactions before cell disruption.

  • Yeast two-hybrid with membrane protein adaptations: Modified Y2H systems specialized for membrane proteins can identify direct interactors.

  • Quantitative proteomics: Compare the mitochondrial proteome between wild-type and COA3-depleted strains to identify affected complexes.

Given Y. lipolytica's efficient mitochondrial metabolism, particularly when grown on hydrophobic substrates like oleic acid , interaction studies should be performed under both fermentative and respiratory conditions to capture condition-specific interactions.

How does COA3 function relate to Y. lipolytica's exceptional lipid metabolism capabilities?

The relationship between COA3 function and Y. lipolytica's lipid metabolism presents a fascinating research area requiring sophisticated methodological approaches:

  • Respiratory capacity assessment: Compare oxygen consumption rates between wild-type and COA3-mutant strains during growth on different carbon sources, particularly oleic acid, where Y. lipolytica exhibits specialized metabolic adaptations .

  • Lipid profiling: Employ lipidomics to quantify changes in membrane lipid composition, particularly cardiolipin, which is critical for respiratory complex stability.

  • Metabolic flux analysis: Use 13C-labeled substrates to trace carbon flow through central metabolism in the presence and absence of functional COA3.

  • Mitochondrial membrane potential measurements: Employ potentiometric dyes (TMRM, JC-1) to assess how COA3 mutations affect the proton gradient driving ATP synthesis.

Y. lipolytica's natural capacity for lipid accumulation (up to 67.66% of dry cell weight in engineered strains) suggests a tightly regulated relationship between respiratory function and lipid metabolism that may be partially mediated through assembly factors like COA3.

What genomic engineering approaches are most effective for studying COA3 function in Y. lipolytica?

For effective genomic engineering of COA3 in Y. lipolytica, implement these methodological strategies:

  • CRISPR-Cas9 optimization: Design sgRNAs with Y. lipolytica codon optimization and appropriate promoters (e.g., SCR1 or SNR52).

  • Homologous recombination enhancement: Y. lipolytica has variable homologous recombination efficiency between strains . Consider using the ku70Δ background to reduce non-homologous end joining.

  • Inducible expression systems: Utilize the LIP2p promoter, which shows superior induction compared to POX2p in oleic acid media , for controlled expression of COA3 variants.

  • Site-directed mutagenesis strategy: Target conserved residues identified through multiple sequence alignment with COA3 homologs from well-studied organisms.

  • Marker recycling: Implement Cre-lox systems for sequential genetic modifications without accumulating selection markers.

The engineering strategy should consider Y. lipolytica's chromosomal rearrangements between strains , which may affect homologous recombination efficiency at the COA3 locus.

How can structural biology approaches be applied to Y. lipolytica COA3?

To obtain structural information about Y. lipolytica COA3, implement these methodological approaches:

  • Cryo-EM analysis: For membrane proteins like COA3, single-particle cryo-EM offers advantages over crystallography, especially when studied in the context of larger respiratory complexes.

  • NMR spectroscopy: For dynamic regions or smaller domains, solution NMR with isotopically labeled protein can provide structural and dynamic information.

  • Crystallization strategy: If pursuing X-ray crystallography, screen:

    • Detergent types (DDM, LMNG, GDN)

    • Lipid additives (especially cardiolipin)

    • Stabilizing interaction partners

    • Crystallization in lipidic cubic phase

  • Computational modeling: Use homology modeling based on known structures of mitochondrial membrane proteins, validated by crosslinking-mass spectrometry data.

  • Hydrogen-deuterium exchange mass spectrometry: Map solvent-accessible regions and protein dynamics in different functional states.

Given Y. lipolytica's unique metabolic adaptations, structural information about its COA3 may reveal species-specific features related to its robust respiratory capacity in lipid-rich environments .

How should I address inconsistent results in COA3 functional assays?

To systematically address inconsistent results in COA3 functional assays:

  • Growth condition standardization: Y. lipolytica's phenotypes are highly responsive to carbon source. Standardize media composition, especially when using oleic acid, which can have batch-to-batch variation. The growth phase is critical as Y. lipolytica exhibits distinct metabolic phases (biomass production, lipogenic, and acid production phases) .

  • Strain verification: Confirm strain identity through molecular methods, as Y. lipolytica strains show significant chromosomal rearrangements that could affect experimental outcomes.

  • Assay normalization approach: For respiratory measurements, normalize to:

    • Total protein content

    • Citrate synthase activity (mitochondrial matrix marker)

    • Copy number of mitochondrial DNA

  • Statistical analysis plan: Implement:

    • Minimum of biological triplicates

    • Appropriate statistical tests (ANOVA with post-hoc analysis)

    • Power analysis to determine sample size requirements

  • Environmental variable control: Monitor and standardize:

    • Dissolved oxygen levels

    • pH fluctuations

    • Temperature consistency

    • Cell density at sampling

What are the common pitfalls in analyzing recombinant Y. lipolytica COA3 expression data?

Common pitfalls in analyzing recombinant Y. lipolytica COA3 expression data include:

  • Reference gene selection issues: Y. lipolytica's gene expression patterns differ significantly from conventional yeasts. When performing qRT-PCR:

    • Validate reference genes under your specific conditions

    • Consider using multiple reference genes (ACT1, TEF1, ALG9)

    • Implement geometric averaging of multiple reference genes

  • Promoter activity variability: The commonly used oleic acid-inducible promoters like LIP2p show variable induction levels depending on:

    • Growth phase

    • Carbon source concentration

    • Strain background

    • Oxygen availability

  • Post-translational modification assessment: Y. lipolytica may have unique post-translational modifications affecting:

    • Protein size on SDS-PAGE

    • Antibody recognition

    • Functional activity

  • Normalization method selection: For Western blot analysis, normalize to:

    • Total protein (Ponceau S staining)

    • Mitochondrial markers (VDAC or citrate synthase)

    • Multiple loading controls

  • Statistical approach limitations: For differential expression analysis:

    • Check for normality before applying parametric tests

    • Use appropriate multiple testing correction

    • Consider non-parametric alternatives when assumptions are violated

How can I optimize COA3 localization studies in Y. lipolytica mitochondria?

For optimal COA3 localization studies in Y. lipolytica mitochondria, implement these methodological refinements:

  • Cell fixation optimization: Y. lipolytica has a robust cell wall requiring modified protocols:

    • Pre-treatment with lyticase (1000 U/mL, 10-15 min)

    • Fixation with 4% paraformaldehyde (avoiding methanol which can extract lipids)

    • Extended permeabilization times (0.2% Triton X-100, 15-20 min)

  • Fluorescent protein selection: Consider:

    • mNeonGreen (brighter than GFP in the oxygen-limited mitochondrial environment)

    • Split-GFP approach for membrane proteins with minimal disruption

    • photoconvertible proteins for pulse-chase localization studies

  • Mitochondrial counter-staining approach: Use:

    • MitoTracker dyes (optimized concentration: 100-250 nM)

    • Antibodies against established mitochondrial markers (ATP synthase, VDAC)

    • Genetically encoded markers like mito-RFP

  • Super-resolution microscopy application: Implement:

    • STED microscopy for submitochondrial localization

    • SIM for dynamic studies with living cells

    • PALM/STORM for precise protein clustering analysis

  • Image analysis refinement: Use:

    • Deconvolution algorithms optimized for mitochondrial structures

    • Colocalization coefficients (Pearson's, Manders')

    • 3D reconstruction to distinguish membrane vs. matrix localization

Y. lipolytica's larger cell size compared to S. cerevisiae facilitates improved resolution in microscopy studies, but requires adjustment of standard yeast imaging protocols.

How might COA3 function in Y. lipolytica be exploited for industrial applications?

The potential industrial applications leveraging COA3 function in Y. lipolytica can be methodically explored through:

  • Respiratory efficiency engineering: Modulate COA3 expression to optimize respiration in production strains, potentially increasing:

    • Growth rate on hydrophobic substrates

    • Acetyl-CoA availability for product synthesis

    • ATP generation efficiency

  • Stress tolerance enhancement: Investigate how COA3 variants affect:

    • Oxidative stress resistance

    • Temperature tolerance

    • Production process robustness

  • Bioproduction pathway integration: Target COA3 modifications to support:

    • β-carotene production efficiency (already demonstrated in Y. lipolytica)

    • Lipophilic compound biosynthesis

    • Biomass yield optimization

  • Scale-up considerations: Develop:

    • Oxygen transfer rate optimization strategies

    • Feeding regimes tailored to respiratory capacity

    • Process analytical technology for real-time respiratory monitoring

Y. lipolytica's natural capacity for efficient lipid metabolism, with engineered strains achieving up to 67.66% lipid content , creates an excellent foundation for COA3-targeted respiratory engineering to further enhance bioproduction capabilities.

What are the most promising approaches for studying COA3's role in mitochondrial disease models?

To investigate COA3's role in mitochondrial disease models using Y. lipolytica:

  • Humanized yeast model creation: Generate Y. lipolytica strains expressing human COA3 variants associated with mitochondrial disorders through:

    • CRISPR-Cas9 gene replacement

    • Codon-optimized synthetic genes

    • Promoter selection for physiological expression levels

  • Phenotypic analysis framework: Systematically assess:

    • Respiratory complex assembly using BN-PAGE

    • Oxygen consumption profiles using high-resolution respirometry

    • ROS production using fluorescent indicators

    • mtDNA stability through qPCR-based copy number analysis

  • Compound screening platform development: Create Y. lipolytica-based screening systems for:

    • Mitochondrial-targeted therapeutic discovery

    • Suppressors of COA3 deficiency

    • Chemical chaperones for misfolded COA3 variants

  • Multi-omics integration strategy: Combine:

    • Transcriptomics to identify compensatory responses

    • Proteomics to map altered protein interactions

    • Metabolomics to characterize metabolic adaptations

Y. lipolytica's robust respiratory metabolism makes it particularly suitable for modeling mitochondrial diseases, potentially offering advantages over S. cerevisiae-based models for respiratory chain defects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.