Recombinant Yarrowia lipolytica Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Introduction to Yarrowia Lipolytica as a Model Organism

Yarrowia lipolytica has emerged as a powerful model organism for the study of mitochondrial biology, particularly for structural and functional analysis of respiratory chain components. This non-conventional, obligate aerobic yeast has gained recognition in recent years due to its unique characteristics that make it valuable for mitochondrial research .

The respiratory chain of Y. lipolytica contains complexes I-IV, one "alternative" NADH-dehydrogenase (NDH2), and a non-heme alternative oxidase (AOX). An interesting feature of this yeast is that the NADH binding site of NDH2 faces the mitochondrial intermembrane space rather than the matrix, making complex I an essential enzyme in Y. lipolytica . This distinctive characteristic has made Y. lipolytica particularly useful for studying mitochondrial proteins and their functions.

Within this context, Formation of crista junctions protein 1 (FCJ1) represents a protein of significant interest due to its critical role in maintaining mitochondrial morphology and function. The availability of genetic tools for manipulating Y. lipolytica has facilitated detailed studies of mitochondrial proteins like FCJ1, contributing valuable insights to our understanding of mitochondrial biology.

Protein Identification and Classification

The FCJ1 protein from Yarrowia lipolytica is classified with several identifiers that facilitate its study and characterization, as detailed in the following table:

CharacteristicInformation
UniProt IDQ6C060
Gene NameFCJ1 (MIC60)
SynonymsMIC60, YALI0F27555g, MICOS complex subunit MIC60, Mitofilin
Ordered Locus NamesYALI0F27555g
Expression Region18-563 amino acids
SpeciesYarrowia lipolytica (strain CLIB 122 / E 150)

This classification system places FCJ1 within the broader context of mitochondrial proteins and facilitates comparative studies across different organisms.

Expression Systems

The recombinant FCJ1 protein from Y. lipolytica has been successfully expressed in Escherichia coli expression systems, which provide an efficient platform for producing sufficient quantities of the protein for research applications . Typically, the mature protein sequence (amino acids 18-563) is used for recombinant expression, with the first 17 amino acids likely representing a signal peptide that is cleaved in the native protein .

To facilitate purification, the recombinant protein is often fused with specific tags, with the N-terminal His-tag being commonly employed . This tag enables efficient purification through affinity chromatography techniques, resulting in high-purity protein preparations suitable for structural and functional studies.

Role in Crista Junction Formation

The primary function of FCJ1, as its name suggests, is in the formation of crista junctions. These are specialized structural elements in mitochondria where the inner boundary membrane connects with the cristae membranes. Crista junctions are critical for maintaining proper compartmentalization within the mitochondria, which in turn affects various mitochondrial functions, including respiration and metabolite transport.

While the exact molecular mechanism by which FCJ1 contributes to crista junction formation is not fully detailed in the available research, its classification as a MICOS complex subunit (MIC60) indicates its participation in the Mitochondrial Contact Site and Cristae Organizing System, which is known to play a central role in maintaining mitochondrial architecture .

Significance in Yarrowia Lipolytica Mitochondrial System

The mitochondrial genome of Y. lipolytica spans approximately 47.9 kb and encodes various components of the respiratory chain, including seven subunits of NADH:ubiquinone oxidoreductase (ND1-6, ND4L), apocytochrome b (COB), three subunits of cytochrome oxidase (COX1, 2, 3), and three subunits of ATP synthetase (ATP6, 8, and 9) .

Study of Mitochondrial Complex I

Y. lipolytica has been established as a valuable model for the structural and functional analysis of mitochondrial complex I. Various genetic tools have been developed that enable the deletion of specific complex I subunits and their subsequent complementation with shuttle plasmids carrying the deleted gene . In this context, recombinant FCJ1 can be studied to understand its relationship with complex I and other respiratory chain components.

Furthermore, the ability to attach a hexa-histidine tag to certain subunits allows for fast and efficient purification of complex I from Y. lipolytica by affinity-chromatography . Similar approaches can be applied to FCJ1, facilitating its isolation and characterization in relation to other mitochondrial complexes.

Genetic Manipulation and Functional Analysis

The established set of genetic tools for Y. lipolytica has proven useful for site-directed mutagenesis of individual subunits of various mitochondrial proteins . This approach enables the identification of functionally important amino acids and helps elucidate structure-function relationships.

In the case of FCJ1, similar genetic manipulations could potentially reveal key residues involved in crista junction formation and interactions with other mitochondrial proteins. Such insights would contribute significantly to our understanding of mitochondrial membrane architecture and dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
MIC60; YALI0F27555g; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-563
Protein Length
Full Length of Mature Protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
MIC60
Target Protein Sequence
STASRLQQAAKPATGSTVGTANGASAASGKPPGATFEGASKQKKKTHKFRNFVLLSTFVG AGAFAGGVYYSLQNDQFQSLFVEYVPAAEHAINYIEEQQLRSGRLKIATPTSKHDVDQST VRVPKSGATWRAVDSTDAATSAKSASSPAANVAKDVASPAPAATASPVSSGSPKTDNTTV PAVRLANDSDPAVKAAVQTFNDLIAVAPSGAAKQLSAKVSTVVDQLQHNVAQIKSEAAEE AKNSINKLNSELAKLKASTGEEISSKVSAAEQQLRNEFAALRAHSEKVYHDRLRVEIEAT KSLVSSHANNLIQAVEAERQKQYAQEIAERVETEREGRLSKLKDLQTSLTQLQDLALKTE QAVDASGRTAALHLAIAKLTGALKGSEPVALGPYVESIRRAAGDDPLLQAALDSIPEVAQ TEGVLTPAQLTIRFKLLEPELRKSSLVPVNAGVAGHLGSLIFSSLLFKKSGVPKGDDVES VLARANIALEQGKLYDAVAEVNTLKGWPRKLASDWLDEGRRRTEIEFLADVIAEEGKLYG ALSSKK
Uniprot No.

Target Background

Function
Formation of crista junctions protein 1 (FCJ1) is a component of the MICOS complex. This complex, located in the mitochondrial inner membrane, plays crucial roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating the formation of contact sites with the outer membrane. FCJ1 is involved in keeping cristae membranes connected to the inner boundary membrane and contributes to protein import through the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Yarrowia lipolytica and why is it significant in recombinant protein research?

Yarrowia lipolytica is a dimorphic oleaginous yeast that has gained significant attention in biotechnology as a promising organism for heterologous protein expression. Unlike conventional yeast species, Y. lipolytica offers several advantages including its ability to grow on various carbon sources and perform complex post-translational modifications.

Y. lipolytica is characterized by its ability to switch between yeast and filamentous growth forms, forming hyphae when exposed to various stresses such as temperature, pH, mechanical stress, or changes in carbon and nitrogen sources . This dimorphic nature can be both an advantage and a challenge in protein expression systems, depending on the specific research application.

From a biotechnological perspective, Y. lipolytica is particularly valuable for the conversion of biomass hydrolysate to lipids and for the expression of complex multi-component enzyme systems . The yeast's natural capacity for lipid accumulation makes it an excellent platform for studying proteins involved in lipid metabolism and mitochondrial function.

What is FCJ1 and what role does it play in mitochondrial structure?

Formation of crista junctions protein 1 (FCJ1) in Yarrowia lipolytica is a core component of the MICOS complex (Mitochondrial Contact Site and Cristae Organizing System). FCJ1 is also known as MIC60 or Mitofilin, as indicated in the gene information . This protein plays a crucial role in maintaining mitochondrial morphology, particularly in the formation and stabilization of crista junctions.

Crista junctions are narrow tubular structures that connect the inner boundary membrane to the cristae in mitochondria. These structures are essential for proper mitochondrial function, including respiration and energy production. FCJ1/MIC60 serves as a core component of the MICOS complex, which is responsible for maintaining these critical structures.

In Y. lipolytica, the full-length mature FCJ1 protein spans amino acids 18-563, with a specific amino acid sequence that contains domains critical for its function in mitochondrial membrane organization . Understanding this protein's structure and function provides valuable insights into fundamental mitochondrial biology across eukaryotic systems.

How does the dimorphic nature of Y. lipolytica affect experimental work with recombinant FCJ1?

The dimorphic nature of Y. lipolytica presents both challenges and opportunities for researchers working with recombinant FCJ1. When Y. lipolytica transitions from yeast form to hyphal growth, there are significant changes in cell morphology, metabolism, and potentially in mitochondrial structure, which may affect FCJ1 expression and function.

For large-scale industrial applications or consistent laboratory experiments, the hyphae formation can be highly unfavorable as it alters culture rheology and changes cell properties, potentially risking the success of cultivation . Additionally, there are indications that filamentation has negative impact on lipid production in Y. lipolytica , which could be relevant when studying mitochondrial proteins like FCJ1 that may influence lipid metabolism.

To address this challenge, researchers have identified gene targets for abolishing hyphae formation. Among these, the deletion of MHY1 has proven to be the most reliable approach, as it consistently prevents hyphae formation under all tested conditions without affecting growth, lipid production/composition, or stress tolerance . This genetic modification provides a valuable tool for creating stable Y. lipolytica strains for recombinant FCJ1 studies.

Researchers should consider using MHY1-deletion strains when designing experiments requiring consistent cell morphology and protein expression, especially for long-term cultures or when studying mitochondrial structure-function relationships involving FCJ1.

What expression systems are most effective for producing recombinant Y. lipolytica FCJ1?

Multiple expression systems can be employed for the production of recombinant Y. lipolytica FCJ1, each with distinct advantages depending on research objectives:

E. coli has been successfully used as an expression host for recombinant Y. lipolytica FCJ1 protein, particularly for producing His-tagged versions of the protein . This bacterial system offers advantages in terms of rapid growth, high protein yields, and established purification protocols for His-tagged proteins.

For researchers seeking more native-like post-translational modifications, Y. lipolytica itself can be engineered as an expression host through several approaches:

  • Integrative multi-copy expression vectors can be constructed using basic plasmids such as p64PT or p67PT, which utilize rDNA or the long terminal repeat (LTR) zeta of Ylt1 as integration targeting sequences and ura3d4 as a multi-copy selection marker .

  • The isocitrate lyase promoter (pICL1) has demonstrated efficacy for controlling heterologous protein expression in Y. lipolytica and could be applied to FCJ1 expression.

  • For complex studies requiring the co-expression of FCJ1 with other MICOS components, Y. lipolytica strains can be engineered to express multiple proteins simultaneously through a two-step approach:

    • Integration of up to three expression vectors containing different heterologous cDNAs via simultaneous transformation into haploid recipient strains

    • Further combinations of different expression cassettes through subsequent diploidisation using selected haploid multi-copy transformants

This methodology allows researchers to create recombinant strains containing three to five different expression cassettes, as verified through Southern blotting techniques .

What purification strategies yield the highest quality recombinant FCJ1 protein?

Purification of recombinant FCJ1 requires careful consideration of its membrane-associated nature and structural complexity. Based on available data, the following purification strategy has proven effective:

For His-tagged recombinant Y. lipolytica FCJ1 protein, a multi-step purification process is recommended:

  • Initial Capture: Affinity chromatography using nickel or cobalt resins to selectively bind the His-tagged FCJ1.

  • Quality Assessment: Following purification, SDS-PAGE analysis should confirm protein purity greater than 90% .

  • Buffer Optimization: The purified FCJ1 protein is typically maintained in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 . This buffer composition helps stabilize the protein structure.

  • Concentration and Storage: The purified protein is typically lyophilized for long-term stability. For experimental use, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended .

When designing purification protocols, researchers should consider that FCJ1 naturally functions within the mitochondrial membrane environment. Therefore, additives that mimic aspects of this environment or stabilize membrane protein structure may enhance protein quality. Detergent screening may be necessary to identify optimal conditions for maintaining FCJ1 in a native-like conformational state following purification.

What experimental controls are critical when validating recombinant FCJ1 function?

When studying recombinant FCJ1 function, several critical experimental controls must be implemented to ensure data validity:

  • Protein Quality Controls:

    • Western blotting to confirm protein identity using specific antibodies against FCJ1 or the His-tag

    • Size exclusion chromatography to verify monodispersity and absence of aggregation

    • Circular dichroism spectroscopy to confirm proper secondary structure formation

  • Functional Controls:

    • Mitochondrial fractions from wild-type Y. lipolytica as positive controls for native FCJ1 function

    • FCJ1-deletion mutants as negative controls

    • Functionally characterized FCJ1 mutants with known effects on crista junction formation

  • Expression System Controls:

    • When using MHY1-deletion strains to prevent hyphae formation, parallel experiments with wild-type strains should be conducted to ensure that the deletion does not independently affect mitochondrial structure or FCJ1 function

    • For multi-copy integration approaches, single-copy controls should be included to assess expression level effects

  • Membrane Interaction Controls:

    • Liposomes lacking FCJ1 to establish baseline membrane behavior

    • Non-mitochondrial membrane proteins to demonstrate specificity of FCJ1 effects

    • Truncated FCJ1 variants lacking key domains to confirm structure-function relationships

These controls help ensure that observed effects are specifically attributable to functional recombinant FCJ1 rather than experimental artifacts or non-specific interactions.

How can researchers effectively study FCJ1 interactions with other MICOS complex components?

Studying FCJ1 interactions with other MICOS complex components requires sophisticated approaches that address the challenges of membrane protein complexes:

  • Co-expression Systems: Y. lipolytica can be engineered for the simultaneous expression of multiple MICOS components using the integrative transformation approach. This method allows for the integration of up to three expression vectors containing different heterologous cDNAs via simultaneous transformation into haploid recipient strains, with further combinations possible through diploidisation . This system provides a platform for studying protein-protein interactions in a cellular context.

  • In vitro Reconstitution: Purified recombinant FCJ1 can be combined with other purified MICOS components in artificial membrane systems (liposomes or nanodiscs) to study complex assembly and functional properties. This approach allows for controlled manipulation of protein ratios and membrane composition.

  • Crosslinking Approaches: Chemical crosslinking coupled with mass spectrometry can capture transient or stable interactions between FCJ1 and other MICOS components, providing insights into complex topology and interaction interfaces.

  • Microscopy Techniques: Super-resolution microscopy or cryo-electron tomography of wild-type and FCJ1-mutant mitochondria can reveal structural changes in crista junctions and MICOS complex organization.

  • Surface Plasmon Resonance: This technique can quantitatively measure binding affinities and kinetics between FCJ1 and other MICOS components, helping to establish a hierarchy of interactions within the complex.

When designing these experiments, researchers should consider the importance of membrane environment and protein orientation, as these factors significantly influence MICOS complex assembly and function.

How does genetic modification of Y. lipolytica affect mitochondrial structure and FCJ1 function?

Genetic modifications in Y. lipolytica can have significant impacts on mitochondrial structure and FCJ1 function, providing valuable research tools:

These genetic tools provide a sophisticated platform for investigating the relationship between cellular morphology, mitochondrial structure, and FCJ1 function in Y. lipolytica.

What analytical techniques provide the most insight into FCJ1 structure-function relationships?

Several advanced analytical techniques offer valuable insights into FCJ1 structure-function relationships:

  • Cryo-Electron Microscopy: This technique can resolve the structure of FCJ1 within the context of the MICOS complex, providing insights into how it contributes to membrane curvature at crista junctions. Sample preparation must carefully preserve native membrane architecture.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This approach can map dynamic regions of FCJ1 and identify domains involved in protein-protein interactions or membrane binding. The technique is particularly valuable for membrane proteins where traditional structural biology approaches are challenging.

  • Site-Directed Mutagenesis Combined with Functional Assays: Systematic mutation of conserved residues in FCJ1 followed by functional testing can identify critical regions for protein function. Expression of these mutants can be achieved using the integrative transformation approaches demonstrated in Y. lipolytica .

  • Liposome Deformation Assays: Purified recombinant FCJ1 can be reconstituted with liposomes to directly assess its ability to induce membrane curvature, a critical function for crista junction formation. This assay provides a quantitative measure of one of FCJ1's key activities.

  • Southern and Western Blotting: These techniques have proven effective for confirming the integration of expression vectors and verifying protein expression in recombinant Y. lipolytica strains . They provide essential validation of genetic modifications before proceeding to functional studies.

  • Domain Swapping Experiments: By creating chimeric proteins that combine domains from FCJ1 homologs across species, researchers can identify conserved functional elements and species-specific adaptations. These experiments can be particularly informative when comparing FCJ1 function between Y. lipolytica and other yeasts.

These complementary approaches provide a comprehensive toolkit for dissecting the structural basis of FCJ1 function in mitochondrial membrane organization.

What strategies can overcome low expression yields of recombinant FCJ1?

Addressing low expression yields of recombinant FCJ1 requires systematic optimization across multiple parameters:

  • Vector Design Optimization:

    • Utilize integrative multi-copy expression vectors with rDNA or the LTR zeta of Ylt1 as integration targeting sequences and ura3d4 as a multi-copy selection marker to increase gene copy number

    • Select appropriate promoters such as the isocitrate lyase promoter (pICL1), which has demonstrated efficacy for heterologous protein expression in Y. lipolytica

    • Optimize codon usage for the expression host to enhance translation efficiency

  • Host Strain Selection:

    • Consider using Y. lipolytica strains with the MHY1 deletion, which prevents hyphae formation without negatively impacting growth or stress tolerance

    • For E. coli expression, specialized strains designed for membrane or difficult-to-express proteins may improve yields

  • Culture Condition Optimization:

    • Systematically test different temperatures, media compositions, and induction parameters

    • For Y. lipolytica, carefully control carbon and nitrogen sources, as these can influence both cell morphology and protein expression

  • Protein Solubility Enhancement:

    • Test various fusion tags or solubility enhancers

    • Optimize cell lysis conditions and buffer compositions to maximize protein recovery

    • Screen detergents for effective membrane protein solubilization if aggregation is observed

  • Co-expression Strategies:

    • Consider co-expressing molecular chaperones to assist with protein folding

    • For functional studies, co-express other MICOS components using the simultaneous transformation approach demonstrated for Y. lipolytica

  • Expression Verification:

    • Use Western blotting to confirm protein expression, as successfully demonstrated for P450scc system proteins in Y. lipolytica

    • Implement small-scale expression tests before scaling up to production levels

By systematically applying these strategies, researchers can often overcome expression challenges and achieve sufficient yields of functional recombinant FCJ1 protein.

How can researchers verify the structural integrity of purified recombinant FCJ1?

Verifying the structural integrity of purified recombinant FCJ1 is essential for ensuring experimental validity. Several complementary approaches can be employed:

  • Electrophoretic Analysis:

    • SDS-PAGE to assess protein purity, which should exceed 90% for high-quality preparations

    • Native PAGE to evaluate oligomeric state and homogeneity

    • Western blotting with specific antibodies to confirm protein identity

  • Spectroscopic Methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content and compare with predicted models

    • Fluorescence spectroscopy to evaluate tertiary structure through intrinsic tryptophan fluorescence

    • Fourier-transform infrared spectroscopy (FTIR) to analyze secondary structure in membrane environments

  • Hydrodynamic Characterization:

    • Size exclusion chromatography to assess monodispersity and detect aggregation

    • Dynamic light scattering to measure particle size distribution

    • Analytical ultracentrifugation to determine oligomerization state

  • Thermal Stability Assessment:

    • Differential scanning calorimetry to measure unfolding transitions

    • Thermal shift assays to evaluate stability under different buffer conditions

    • Monitoring activity or structural parameters after incubation at various temperatures

  • Functional Verification:

    • Lipid binding assays to confirm membrane interaction capacity

    • Protein-protein interaction studies with known binding partners

    • Electron microscopy of FCJ1-membrane complexes to visualize structural effects

These approaches provide complementary information about different aspects of FCJ1 structure, from primary sequence confirmation to higher-order structural organization. Together, they establish a comprehensive profile of protein structural integrity before proceeding to functional studies.

What are the optimal storage conditions for maintaining FCJ1 stability and activity?

Maintaining FCJ1 stability and activity requires careful attention to storage conditions, as membrane-associated proteins are often prone to aggregation and denaturation:

  • Short-term Storage:

    • For working aliquots, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles, as this can lead to protein degradation and loss of activity

  • Long-term Storage:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • For liquid formulations, store aliquoted samples at -80°C

    • Add glycerol to a final concentration of 5-50% (with 50% being recommended) for frozen storage

  • Reconstitution Protocol:

    • Prior to opening, briefly centrifuge vials to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Allow complete rehydration before functional studies

  • Buffer Composition:

    • The recommended storage buffer is a Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Trehalose serves as a cryoprotectant to enhance protein stability during freeze-thaw cycles

    • For membrane proteins like FCJ1, consider including mild detergents or lipids to maintain native-like structure

  • Stability Monitoring:

    • Periodically verify protein integrity using SDS-PAGE and activity assays

    • Consider implementing accelerated stability studies to predict long-term storage viability

    • Document batch variability to establish consistent quality control parameters

Following these guidelines will help ensure that recombinant FCJ1 retains its structural integrity and functional properties throughout storage, reconstitution, and experimental use.

How might FCJ1 structure-function studies inform our understanding of mitochondrial diseases?

Research on Y. lipolytica FCJ1 has significant potential to advance our understanding of mitochondrial diseases through several pathways:

These research directions could ultimately lead to improved diagnostic approaches and potential therapeutic strategies targeting mitochondrial membrane organization in human diseases.

What emerging technologies will advance FCJ1 research in the next decade?

Several emerging technologies are poised to revolutionize FCJ1 research in the coming decade:

  • Cryo-Electron Tomography: This technique will enable visualization of FCJ1 and the MICOS complex in situ, providing unprecedented insights into native structural arrangements within mitochondrial membranes. Advances in sample preparation and image processing will allow for higher resolution and more detailed structural information.

  • Advanced Genetic Tools: The continued development of CRISPR-Cas9 and other genome editing approaches for Y. lipolytica will facilitate more precise and efficient genetic modifications. The two-step approach for constructing recombinant strains will be enhanced with new selection markers and integration strategies.

  • Single-Molecule Biophysics: Techniques such as single-molecule FRET, optical tweezers, and high-speed atomic force microscopy will allow direct observation of FCJ1 dynamics and mechanical properties, revealing how this protein shapes membrane curvature at the molecular level.

  • Integrative Structural Biology: Combining data from multiple structural techniques (X-ray crystallography, NMR, cryo-EM, crosslinking mass spectrometry) will generate comprehensive models of FCJ1 and the MICOS complex, highlighting dynamic regions and interaction interfaces.

  • Artificial Membrane Systems: Advanced liposome and nanodisc technologies will enable reconstitution of FCJ1 in increasingly physiological membrane environments, allowing for controlled studies of protein function and interactions.

  • Systems Biology Integration: Multi-omics approaches linking proteomic, lipidomic, and metabolomic profiles with FCJ1 function will provide a systems-level understanding of how mitochondrial membrane organization influences cellular physiology.

These technological advances will collectively enable more detailed and physiologically relevant studies of FCJ1 structure and function, accelerating our understanding of this critical mitochondrial protein.

How can Y. lipolytica FCJ1 research contribute to biotechnological applications?

Y. lipolytica FCJ1 research offers several promising avenues for biotechnological applications:

  • Metabolic Engineering Platform: Understanding FCJ1's role in mitochondrial organization could inform strategies to optimize Y. lipolytica as a cell factory. The connection between mitochondrial function and lipid accumulation suggests that engineered FCJ1 variants might enhance biofuel or oleochemical production.

  • Protein Expression System Enhancement: The methodologies developed for heterologous protein expression in Y. lipolytica, such as integrative multi-copy expression vectors and controlled morphology through MHY1 deletion , provide valuable tools for optimizing this yeast as a protein production platform for industrial and pharmaceutical applications.

  • Mitochondrial Disease Model: Y. lipolytica expressing engineered FCJ1 variants could serve as a screening platform for compounds that rescue mitochondrial membrane defects, potentially identifying therapeutic leads for human mitochondrial disorders.

  • Synthetic Biology Applications: The detailed understanding of how FCJ1 shapes mitochondrial membranes could inspire biomimetic approaches for designing synthetic cellular systems with programmable membrane organization for biotechnological applications.

  • Biocatalysis Optimization: Improved understanding of mitochondrial membrane organization through FCJ1 research could lead to strategies for enhancing the performance of mitochondrial enzymes used in biocatalysis applications, particularly for oxidation reactions.

  • Stress-Resistant Strain Development: The finding that MHY1 deletion abolishes hyphae formation without significantly affecting stress tolerance provides a foundation for developing industrially robust Y. lipolytica strains with stable morphology under diverse process conditions.

These applications highlight how fundamental research on Y. lipolytica FCJ1 can translate into practical biotechnological advances across multiple sectors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.