Recombinant Yarrowia lipolytica Glyoxylate pathway regulator (GPR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Yarrowia lipolytica Glyoxylate Pathway Regulator (GPR1)

Recombinant Yarrowia lipolytica GPR1 is a full-length glyoxylate pathway regulator protein (UniProt ID: P41943) expressed in E. coli with an N-terminal His-tag. It plays a critical role in cellular adaptation to acetic acid stress and regulates metabolic pathways linked to carbon utilization. The protein is widely used in biochemical studies to investigate stress responses, membrane biology, and glyoxylate cycle dynamics in non-conventional yeast systems.

Domain Architecture

GPR1 contains five to six transmembrane-spanning regions, classifying it as an integral membrane protein localized to the plasma membrane . Key functional motifs include:

  1. (A/G)NPAPLGL: A conserved domain linked to glyoxylate pathway regulation.

  2. SYG(X)FW: A motif associated with stress-responsive signaling .

  3. FGGTLN: An N-terminal sequence critical for protein function, as shown by deletion studies .

Localization and Membrane Integration

Subcellular fractionation and fluorescence microscopy confirm GPR1’s localization to the plasma membrane, where it interacts with membrane lipids and regulates stress adaptation .

Acetic Acid Sensitivity

  • Mechanism: GPR1 is induced under acetic acid stress and repressed by glucose. Its disruption slows adaptation to acetic acid but does not impair growth on alternative carbon sources .

  • Trans-Dominant Mutations: Mutations in GPR1 (e.g., GPR1d alleles) cause hypersensitivity to low acetic acid concentrations, even in the presence of glucose. This phenotype is pH-dependent, with maximal toxicity observed at low pH .

Ethanol Tolerance

GPR1d mutants exhibit ethanol sensitivity, though one mutant retained partial ethanol utilization, suggesting distinct regulatory pathways for acetic acid and ethanol stress .

Regulation and Expression

FactorEffect on GPR1 ExpressionReference
Acetic AcidInduces expression
GlucoseRepresses expression
Ylt1 RetrotransposonModulates promoter activity (e.g., GPR1A vs. GPR1B promoters)

Applications in Research and Biotechnology

  1. Stress Response Studies: Recombinant GPR1 is used to model membrane integrity and signaling during acetic acid exposure .

  2. Strain Engineering: Overexpression or deletion of GPR1 alters acetate utilization efficiency, enabling metabolic engineering for biofuel production .

  3. Transcriptional Regulation: GPR1 interacts with transcription factors (e.g., TFs involved in glyoxylate pathway regulation) to fine-tune heterologous protein synthesis in Y. lipolytica .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparations.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during the production process. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
GPR1; YALI0C23617g; Glyoxylate pathway regulator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
Target Protein Sequence
MNTEIPDLEKQQIDHNSGSDDPQPIHDDMAPVSRIRSSGPNHEYIHIADQKFHRDDFYRA FGGTLNPGGAPQPSRKFGNPAPLGLSAFALTTLVFSLCTVQARGVPNPSIAVGLALFYGG VCQFAAGMWEFVQENTFGAAALTSYGGFWMSWAAIEMNAFGIKDSYNDPIEVQNAVGIYL FGWFIFTLMLTLCTLKSTVAFFGLFFMLMMTFLVLACANVTQHHGTAIGGGWLGIITAFF GFYNAYAGLANPGNSYIVPVPLDMPFVKKD
Uniprot No.

Target Background

Function

This protein plays a role in adapting cellular metabolism to acetic acid utilization. Its mechanism of action likely involves the inhibition of an anion-transporting ATPase and influences the plasma membrane H(+)-ATPase. It may also indirectly repress the expression of genes encoding glyoxylate cycle enzymes.

Database Links
Protein Families
Acetate uptake transporter (AceTr) (TC 2.A.96) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is GPR1 expression regulated in Y. lipolytica?

GPR1 expression demonstrates carbon source-dependent regulation. Research has established that:

  • GPR1 expression is significantly induced in the presence of acetic acid in the growth medium .

  • GPR1 expression is moderately repressed by glucose .

  • The regulation pattern suggests a role in adaptation to non-fermentable carbon sources, particularly acetic acid.

For researchers studying GPR1 expression, quantitative RT-PCR analysis should be conducted using cells grown in media containing different carbon sources (glucose, acetate, glycerol) to accurately assess expression levels. When designing such experiments, it's crucial to harvest cells at multiple time points to capture the dynamic nature of GPR1 regulation during adaptation to different carbon sources.

What post-translational modifications occur in GPR1 and how do they affect its function?

The primary post-translational modification identified in GPR1 is phosphorylation, which occurs in a carbon source-dependent manner. Key findings include:

  • Phosphorylation specifically occurs at serine-37 in the N-terminal region of the protein .

  • The phosphorylation state of GPR1 is dynamic and responsive to carbon source availability:

    • Complete dephosphorylation occurs upon carbon source exhaustion

    • Addition of a new carbon source triggers phosphorylation

    • Acetate addition results in phosphorylation of almost all GPR1 molecules

    • Other carbon sources only trigger phosphorylation of approximately 50% of GPR1 molecules

While phosphorylation is clearly regulated by carbon source availability, particularly acetate, research has not established a direct correlation between phosphorylation status and acetic acid hypersensitivity caused by mutations within GPR1 . This suggests that phosphorylation may regulate other aspects of GPR1 function not directly related to acetic acid adaptation.

To study GPR1 phosphorylation experimentally, researchers should:

  • Use phospho-specific antibodies or phosphoproteomic approaches

  • Implement site-directed mutagenesis of Ser-37 (e.g., S37A to prevent phosphorylation or S37D to mimic constitutive phosphorylation)

  • Assess phenotypic consequences of these mutations under various carbon source conditions

How does GPR1 contribute to acetic acid adaptation in Y. lipolytica?

GPR1 plays a significant role in the adaptation of Y. lipolytica to acetic acid, particularly at low pH. Research findings indicate:

  • Deletion of GPR1 slows adaptation to acetic acid, although it doesn't completely prevent growth in acetic acid-containing media .

  • Trans-dominant mutations in the GPR1 gene result in acetic acid hypersensitivity at low pH values .

  • Multiple mutations within different regions of GPR1 can induce this acetic acid hypersensitivity phenotype .

  • The C-termini of mutated GPR1 proteins are necessary for triggering acetic acid sensitivity .

Importantly, functional analysis has identified the amino acid sequence FGGTLN as critical for GPR1's function in adaptation to acetic acid in Y. lipolytica . This sequence likely participates in protein-protein interactions or specific conformational changes required for proper function.

For researchers investigating GPR1's role in acetic acid adaptation, experimental approaches should include:

  • Growth assays with wild-type, GPR1 deletion mutants, and strains expressing mutant GPR1 variants in media with different concentrations of acetic acid and pH values

  • Transcriptomic analysis to identify genes differentially expressed in response to acetic acid in wild-type versus GPR1 mutants

  • Metabolic profiling to determine how GPR1 affects cellular metabolism during acetic acid adaptation

What is the relationship between GPR1 and lipid metabolism in Y. lipolytica?

While GPR1 is primarily studied for its role in acetic acid adaptation, there are potential connections to lipid metabolism in Y. lipolytica, which is known for its oleaginous properties. The limited data suggests:

  • GPR1, as a membrane protein involved in carbon source utilization, may indirectly influence lipid accumulation pathways.

  • The SNF1 pathway, a master regulator of carbon metabolism in yeasts, plays a key role in the transition from growth phase to oleaginous phase in Y. lipolytica .

  • Since GPR1 is regulated by carbon source availability, there might be crosstalk between GPR1 signaling and the SNF1 pathway.

A comparative analysis of lipid accumulation in wild-type versus GPR1 mutant strains under nitrogen-limited conditions would help clarify this potential relationship. Researchers should measure:

  • Total lipid content

  • Fatty acid composition

  • Expression of key lipogenic genes

  • Activity of rate-limiting enzymes in lipid biosynthesis

What are the optimal conditions for recombinant expression of Y. lipolytica GPR1?

For researchers aiming to produce recombinant GPR1 for structural or functional studies, consider these methodological guidelines:

Expression System Options:

  • E. coli expression: Challenges include potential misfolding of this membrane protein. Consider fusion tags (MBP, SUMO) to enhance solubility.

  • Yeast expression systems: Y. lipolytica itself or S. cerevisiae can provide a more native environment for proper folding.

  • Cell-free systems: May be beneficial for this membrane protein when supplemented with appropriate lipids.

Optimization Parameters:

  • Temperature: Lower temperatures (25°C rather than 30°C) often improve proper folding of membrane proteins .

  • Secretory helpers: Co-expression with secretory pathway enhancers like SSO1 or CWP11 may improve yield .

  • Induction conditions: For heterologous systems, test various induction times and inducer concentrations.

  • Detergent screening: For purification, test multiple detergents to maintain protein stability and native conformation.

Purification Approach:

  • Affinity chromatography using appropriate tags (His, FLAG)

  • Size exclusion chromatography to separate monomeric from oligomeric forms

  • Assessment of protein quality by circular dichroism to confirm proper folding

What methodologies are most effective for studying GPR1 oligomerization?

Evidence suggests that GPR1 exists in an oligomeric state . To investigate this property:

  • Biochemical approaches:

    • Blue native PAGE to separate native protein complexes

    • Chemical crosslinking followed by SDS-PAGE and western blotting

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

  • Biophysical methods:

    • Fluorescence resonance energy transfer (FRET) using fluorescently-tagged GPR1 variants

    • Bimolecular fluorescence complementation (BiFC) with split fluorescent proteins

    • Single-molecule imaging to directly visualize protein clustering in the membrane

  • Genetic approaches:

    • Yeast two-hybrid assays with membrane-based variants

    • Split-ubiquitin assays specifically designed for membrane protein interactions

When interpreting oligomerization data, researchers should consider that membrane protein oligomerization can be affected by detergent choice during extraction and that different oligomeric states may exist under different physiological conditions.

How do GPR1 orthologs in S. cerevisiae compare functionally to Y. lipolytica GPR1?

Comparative analysis between Y. lipolytica GPR1 and its S. cerevisiae orthologs (YCR010c/ATO1 and YNR002c/ATO2) reveals both similarities and differences:

  • Functional similarity: Mutations in both Y. lipolytica GPR1 and S. cerevisiae orthologs cause trans-dominant acetic acid hypersensitivity .

  • Structural conservation: Both contain similar transmembrane topology and conserved motifs characteristic of the Gpr1/Fun34/YaaH protein family.

  • C-terminal importance: The C-termini of mutated Gpr1p, Ycr010cp, and Ynr002cp are all necessary for triggering acetic acid sensitivity .

This cross-species conservation suggests a fundamental role for these proteins in organic acid adaptation across various yeast species. For researchers conducting comparative studies:

  • Complementation experiments should be performed to determine if S. cerevisiae orthologs can rescue Y. lipolytica GPR1 deletion phenotypes and vice versa.

  • Chimeric proteins containing domains from both species' proteins can help identify functionally critical regions.

  • Comparative transcriptomic analysis of the response to acetic acid in both species can reveal conserved and divergent downstream pathways.

What are the methodological approaches for studying GPR1 phosphorylation dynamics?

To thoroughly investigate the carbon source-dependent phosphorylation of GPR1:

Experimental Approaches:

  • Time-course phosphorylation analysis:

    • Shift cells between different carbon sources and analyze phosphorylation status at frequent intervals

    • Use Phos-tag SDS-PAGE followed by western blotting for improved separation of phosphorylated forms

    • Implement quantitative mass spectrometry to determine the exact percentage of phosphorylated protein

  • Kinase and phosphatase identification:

    • Conduct kinase inhibitor screens to identify enzymes responsible for GPR1 phosphorylation

    • Perform phosphatase inhibitor studies to understand dephosphorylation regulation

    • Use yeast kinase/phosphatase deletion libraries to systematically test candidates

  • Functional implications:

    • Generate phosphomimetic (S37D) and phosphodeficient (S37A) mutants

    • Assess membrane localization, protein stability, and protein-protein interactions of these variants

    • Measure their ability to complement GPR1 deletion phenotypes under various stress conditions

Data Interpretation Guidelines:

  • Consider that phosphorylation may affect multiple aspects of protein function simultaneously

  • Examine correlations between phosphorylation status and various cellular processes beyond just acetic acid sensitivity

  • Use quantitative rather than qualitative measurements when possible to detect subtle effects

What key questions remain unanswered about GPR1 function and regulation?

Despite progress in understanding GPR1, significant knowledge gaps remain:

  • Molecular mechanism:

    • The precise molecular function of GPR1 remains uncharacterized – does it function as a transporter, sensor, or scaffolding protein?

    • What are the direct interaction partners of GPR1 in the membrane?

    • How does the oligomeric state affect function?

  • Regulatory networks:

    • What transcription factors directly control GPR1 expression?

    • Beyond phosphorylation, are there other post-translational modifications?

    • How is GPR1 turnover and degradation regulated?

  • Physiological role:

    • Does GPR1 play roles in adaptation to other weak acids beyond acetic acid?

    • What is the evolutionary advantage of maintaining this protein family in lower eukaryotes?

    • How does GPR1 function integrate with broader metabolic networks?

Future research should employ integrative approaches combining structural biology, systems biology, and single-cell analysis to address these questions and develop a comprehensive model of GPR1 function.

How can CRISPR-Cas9 technology be optimized for studying GPR1 in Y. lipolytica?

CRISPR-Cas9 genome editing offers powerful approaches for GPR1 research:

Optimization Strategies:

  • Guide RNA design:

    • Use Y. lipolytica-specific algorithms to design efficient gRNAs

    • Target conserved regions for knockout studies

    • Design repair templates for precise mutations (e.g., phosphorylation site mutations)

  • Delivery methods:

    • Optimize transformation protocols specific for Y. lipolytica

    • Consider ribonucleoprotein (RNP) complex delivery versus plasmid-based systems

    • Use appropriate selectable markers for this non-conventional yeast

  • Advanced applications:

    • Implement CRISPRi (interference) for tunable repression of GPR1

    • Use CRISPRa (activation) to upregulate GPR1 under normally repressive conditions

    • Create fluorescent protein fusions at the native locus for live-cell imaging

Experimental Design Considerations:

  • Include proper controls to verify editing efficiency

  • Validate edited strains by sequencing and expression analysis

  • Assess potential off-target effects, especially if creating strains for industrial applications

By implementing these advanced genome editing approaches, researchers can create precise genetic variants to dissect GPR1 function with unprecedented resolution.

What statistical approaches are most appropriate for analyzing GPR1 mutant phenotypes?

When evaluating growth, adaptation rates, and other phenotypes of GPR1 mutants:

Recommended Statistical Methods:

Experimental DesignAppropriate Statistical TestNotes for Implementation
Growth curve comparisonRepeated measures ANOVAAccount for time-dependent measurements
Endpoint growth comparisonStudent's t-test or ANOVA with post-hoc testsUse for comparing multiple strains/conditions
Adaptation time assessmentKaplan-Meier analysisTreats adaptation as a time-to-event outcome
Multi-factor experimentsFactorial ANOVAFor experiments testing combinations of pH, carbon source, etc.
Non-normal distributionsNon-parametric tests (Mann-Whitney, Kruskal-Wallis)When data violates normality assumptions

Sample Size Considerations:

  • Conduct power analysis before experiments to determine appropriate replicate numbers

  • For growth assays, minimum n=3 biological replicates with 3 technical replicates each

  • For more subtle phenotypes, increase to n=5-6 biological replicates

Control Implementation:

  • Always include wild-type strains grown under identical conditions

  • Include empty vector controls for complementation studies

  • Consider including known mutants with characterized phenotypes as reference points

How should researchers interpret contradictory findings about GPR1 function?

The literature contains some apparent contradictions regarding GPR1 function, particularly concerning the relationship between phosphorylation and acetic acid sensitivity. When navigating these contradictions:

  • Consider strain background differences:

    • Genetic background can significantly influence phenotypic outcomes

    • Document the complete genotype of strains used in studies

    • Test key findings in multiple strain backgrounds when possible

  • Evaluate methodological differences:

    • Growth conditions (media composition, pH, temperature) can affect results

    • Measurement techniques may have different sensitivities

    • Timing of measurements may capture different phases of adaptation

  • Embrace complexity:

    • GPR1 likely has multiple functions that may appear contradictory in isolation

    • Consider context-dependent protein interactions and modifications

    • Develop integrative models that accommodate seemingly contradictory observations

  • Resolution strategies:

    • Design experiments that directly test competing hypotheses

    • Use multiple complementary techniques to measure the same phenomenon

    • Collaborate with groups reporting contradictory results to standardize methods

By taking this nuanced approach to contradictory findings, researchers can develop more comprehensive and accurate models of GPR1 function.

How can understanding GPR1 function contribute to metabolic engineering of Y. lipolytica?

Y. lipolytica is increasingly used as a platform organism for the production of lipids, proteins, and other valuable compounds. Understanding GPR1 function can enhance these applications:

  • Acetic acid tolerance engineering:

    • Manipulate GPR1 to improve growth on acetic acid-containing feedstocks

    • Develop strains capable of utilizing acetic acid-rich industrial waste streams

    • Create variants with optimized phosphorylation dynamics for specific process conditions

  • Protein production enhancement:

    • Leverage knowledge of secretory pathway interactions with GPR1

    • Optimize membrane protein expression systems based on GPR1 biology

    • Develop improved secretion tags based on GPR1 domains

  • Biosensor development:

    • Use GPR1 or modified variants as biosensors for acetic acid levels

    • Develop reporter systems based on GPR1 phosphorylation status

    • Create synthetic circuits integrating GPR1-based sensing with metabolic outputs

These applications represent the translation of fundamental GPR1 research into biotechnological innovations with potential industrial impacts.

What are the most promising directions for structural studies of GPR1?

Understanding the three-dimensional structure of GPR1 would significantly advance our knowledge of its function. Researchers should consider:

  • Cryo-electron microscopy approaches:

    • Particularly suitable for membrane proteins like GPR1

    • Can capture different conformational states and oligomeric arrangements

    • Requires optimization of sample preparation and detergent selection

  • X-ray crystallography challenges and solutions:

    • Screening multiple detergents and lipid cubic phase methodologies

    • Creating stabilized variants through mutagenesis or fusion partners

    • Focusing on obtaining structures of critical domains if full-length protein proves refractory

  • Computational structure prediction:

    • Leverage AlphaFold2 and other AI-based structure prediction tools

    • Validate predictions with targeted experimental approaches

    • Use predicted structures to guide hypothesis generation about functional domains

  • Functional validation of structural insights:

    • Design mutations based on structural information

    • Probe conformational changes during phosphorylation

    • Identify potential binding pockets for ligands or interaction partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.