Recombinant Yarrowia lipolytica Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Description

Introduction

The Get1/2 complex is essential for the insertion of tail-anchored (TA) proteins into the endoplasmic reticulum (ER) membrane . TA proteins play critical roles in various cellular processes, and their proper localization is vital for cell function . The Get1/2 complex acts as an insertase, directly contacting the transmembrane domain (TMD) of TA substrates during their insertion into the ER membrane .

Yarrowia lipolytica is a yeast known for its protein secretion capabilities and its use in various biotechnological applications . Recombinant production of proteins in Y. lipolytica allows for the synthesis and study of proteins like Get1, which are involved in essential cellular pathways.

Get1/2 Complex Function

Key aspects of Get1/2 function:

  • Insertase activity The Get1/2 complex directly interacts with the TMD of TA proteins, facilitating their insertion into the ER membrane .

  • Subunit cooperation The Get1 and Get2 subunits cooperate to capture and remodel the targeting complex, which is essential for efficient TA protein insertion .

  • Get3 opening The Get2 subunit induces the opening of Get3, a crucial step for TA insertion in vivo .

Get1/2 and ER-Golgi Traffic

ER-Golgi traffic is essential for protein quality control and ER degradation . The degradation of misfolded proteins in the ER requires a competent early secretory pathway . Mutations in proteins involved in ER-Golgi protein traffic can severely inhibit ER degradation .

Studying Get1/2 Function

Researchers use various techniques to study the Get1/2 complex and its role in TA protein insertion.

Common methods include:

  • Cell reporters GFP cell reporters can monitor heat shock factor transcriptional activity, indicating compromised Get1/2 function .

  • Biochemical reconstitution This method helps define mutations in the Get1/2 transmembrane domain that disrupt TA protein insertion .

  • Crosslinking studies Crosslinking experiments identify interactions between Get1/2 and TA proteins during the insertion process .

  • Pulse-chase assays These assays measure the insertion kinetics of newly synthesized TA proteins .

Mutations and Functional Analysis

Mutations in the Get1/2 complex can disrupt its function and affect TA protein insertion . For example, mutations in the transmembrane domain of Get1/2 can result in the loss of Get2-1sc function, leading to elevated heat shock factor activity . Similarly, mutations in the H1 and H2 motifs of Get2 can cause delays in TA insertion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
GET1; YALI0E20889g; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
GET1
Target Protein Sequence
MDEAIIVDAEFVAPVGTTAGEFVPIDRAPAAGLLLLVAFVVLYAKVISKLGKPAIQEFLW EIITRIVPSKQLRRRKEAQLRAIEVHTQRSNTSSQDQFAKWAKLDREYGKLKVEIEDINN LLTASKARFFTIISSAIFLSTTGMKMFLRIKHRKAAIFWLPKNAFPYPIEYILSFSSAPL GSVSVSAWLMICDAAMDLIVTIFVALVVGVIGMLRSNKVKPKTA
Uniprot No.

Target Background

Function
Essential for post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). GET1, in conjunction with GET2, functions as a membrane receptor for soluble GET3. GET3 recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex, in collaboration with the HDEL receptor ERD2, facilitates ATP-dependent retrieval of ER resident proteins (possessing a C-terminal H-D-E-L retention signal) from the Golgi apparatus back to the ER.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Yarrowia lipolytica and why is it significant for GET1 research?

Yarrowia lipolytica is a dimorphic oleaginous yeast that has garnered substantial interest in biotechnological applications due to its versatile metabolic capabilities. This non-conventional yeast has emerged as a valuable model organism for studying various cellular processes, including protein trafficking pathways. Y. lipolytica is classified as a Biosafety Level (BSL) 1 microorganism by the Public Health Service and has received GRAS (Generally Recognized As Safe) status from the FDA, making it suitable for laboratory research without extensive safety precautions .

The significance of Y. lipolytica for GET1 research stems from its unique cellular physiology and protein trafficking mechanisms that may differ from conventional model yeasts like Saccharomyces cerevisiae. These differences provide valuable comparative insights into the evolutionary conservation and specialization of the GET pathway across fungal species. Additionally, Y. lipolytica's robust secretory capacity makes it an excellent system for studying membrane protein insertion mechanisms.

What is the GET pathway and what role does GET1 play in it?

The GET (Guided Entry of Tail-anchored proteins) pathway is a conserved cellular mechanism responsible for the post-translational insertion of tail-anchored (TA) proteins into the endoplasmic reticulum (ER) membrane. TA proteins contain a single C-terminal transmembrane domain (TMD) that is recognized and captured by the cytosolic ATPase Get3 in yeast (TRC40 in humans) .

GET1, as part of the heteromeric Get1/2 complex in the ER membrane, serves as the membrane insertase that facilitates the final step of TA protein integration. Recent research has revealed that the Get1/2 complex forms a hydrophilic channel approximately 2.5 nm in diameter in the lipid bilayer . This channel has dual functionality:

  • As an insertase that facilitates the lateral release of TMDs of TA proteins into the lipid bilayer

  • As a translocase that allows the C-terminal hydrophilic segments of TA proteins to cross the membrane barrier

The Get1/2 channel exhibits dynamic open-close properties, with Get3 binding capable of sealing the channel, thus maintaining membrane integrity during the insertion process .

How does GET1 function differ between Golgi-to-ER trafficking and TA protein insertion?

It's important to clarify a common misconception: GET1 (Golgi to ER Traffic protein 1) is primarily involved in TA protein insertion rather than retrograde Golgi-to-ER trafficking. The similar nomenclature can cause confusion.

In Yarrowia lipolytica, as in other yeasts, GET1 functions specifically in the insertion of tail-anchored proteins into the ER membrane as described above. In contrast, retrograde Golgi-to-ER trafficking of proteins involves distinct machinery, including proteins like Erd1, which has been shown to play a crucial role in recycling Golgi glycosyltransferases .

Erd1 facilitates the stable interaction between Golgi enzymes and the cytosolic receptor Vps74, allowing efficient recycling of these enzymes from late Golgi to early Golgi compartments via COPI vesicles . While both pathways involve protein movement related to the ER, they employ separate molecular mechanisms and serve different cellular functions.

What are the recommended techniques for characterizing GET1 channel activity?

Characterizing the channel activity of recombinant Y. lipolytica GET1 requires specialized techniques that can detect and measure channel conductance in membrane environments. Based on current research methodologies, the following approaches are recommended:

  • Bulk Fluorescence Assays: These assays utilize NBD-conjugated lipids in small unilamellar vesicles (SUVs) with reconstituted Get1/2 complex. The membrane-impermeable sodium dithionite quencher is added to determine if the channel allows passage across the membrane by measuring fluorescence quenching of inward-facing NBDs .

  • Microfluidics-Based Single Channel Recordings: This technique provides direct measurement of channel conductance and can reveal the dynamic opening and closing of the Get1/2 channel. It allows researchers to estimate channel diameter and investigate conditions that affect channel gating .

  • Protease Protection Assays: These can be used to determine the orientation of reconstituted Get1/2 in membrane vesicles, which is crucial for interpreting channel activity results. Proteinase K digestion can reveal the percentage of correctly oriented protein in the reconstituted system .

When designing these experiments, it is essential to include appropriate controls. Non-channel-forming membrane proteins (e.g., tSNARE or vSNARE) serve as negative controls, while established channel proteins like α-hemolysin can function as positive controls for channel formation .

How should researchers design mutation studies to investigate GET1 channel properties?

When designing mutation studies to investigate the channel properties of Y. lipolytica GET1, researchers should consider the following methodological approach:

  • Target Charged Residues in Transmembrane Domains: Focus on positively charged amino acids within the transmembrane domains, as these often contribute to channel formation and ion conductance. For example, in Get2, positively charged residues (K150 and K157) in the first TMD have been shown to contribute to forming the Get1/2 channel .

  • Conservative and Non-Conservative Substitutions: Design mutations that alter charge (e.g., lysine to alanine) to test the role of electrostatic interactions, as well as more conservative substitutions (e.g., lysine to arginine) to test the importance of specific residues versus general charge properties.

  • Combine Structural Predictions with Functional Testing: Use structural bioinformatics to predict potentially important residues, then validate these predictions with functional assays.

  • Assess Multiple Channel Properties: For each mutant, evaluate:

    • Channel formation efficiency (using fluorescence-based assays)

    • Channel conductance (using electrophysiological measurements)

    • Get3 binding capacity (using binding assays)

    • TA protein insertion efficiency (using reconstitution assays)

  • Experimental Design Considerations: Ensure proper experimental design with controls, randomization, and sufficient replication to generate statistically valid data . The validity of statistical inferences depends heavily on proper experimental design.

What purification strategies are most effective for recombinant Y. lipolytica GET1?

The purification of recombinant Y. lipolytica GET1 presents challenges common to membrane protein isolation. Based on established protocols for Get1/2 complex purification, the following strategies are recommended:

  • Expression System Selection:

    • For structural and biochemical studies, E. coli-based expression systems with specialized strains (C41/C43) can be effective

    • For functional studies requiring post-translational modifications, yeast expression systems (preferably Y. lipolytica itself) may be more appropriate

    • Consider fusion tags that enhance expression and solubility (e.g., MBP, SUMO)

  • Membrane Protein Extraction:

    • Use mild detergents like n-Dodecyl β-D-maltoside (DDM) or digitonin for initial solubilization

    • Perform extraction at 4°C with protease inhibitors to prevent degradation

    • Consider using lipid nanodiscs or amphipols for maintaining native-like environments

  • Chromatography Sequence:

    • Initial capture using affinity chromatography (His-tag or other fusion tags)

    • Intermediate purification using ion exchange chromatography

    • Final polishing using size exclusion chromatography to ensure homogeneity and remove aggregates

  • Quality Control Assessments:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Circular dichroism to assess secondary structure

    • Thermal stability assays to optimize buffer conditions

    • Functional reconstitution to confirm activity of purified protein

When working with Get1, co-purification with Get2 is often advantageous as the heteromeric complex typically exhibits greater stability and functional relevance compared to the individual subunits .

How can genetic interaction networks inform our understanding of GET1 function?

Genetic interaction networks provide powerful insights into the functional relationships between genes and can reveal unexpected connections between different cellular pathways. For GET1 research in Y. lipolytica, the following approaches are particularly valuable:

  • Spatial Analysis of Functional Enrichment (SAFE): This technique identifies regions of global similarity networks that are significantly enriched for genes exhibiting negative or positive genetic interactions with GET1. This approach has been successfully applied to identify functional relationships between genes involved in ER-Golgi trafficking, as demonstrated with Erd1 .

  • Profile Similarity Networks (PSN): By correlating genetic interaction profiles, PSN analysis can identify genes with functions related to GET1. This method allows annotation of genes with related functions and can reveal whether GET1 clusters with genes involved in specific cellular processes .

  • Systematic Genetic Interaction Mapping: Creating double mutants combining GET1 deletion/mutation with genome-wide collections of gene deletions can identify synthetic lethal or synthetic rescue interactions. These interactions often indicate functional relationships between the corresponding gene products.

  • Integration with Physical Interaction Data: Combining genetic interaction data with protein-protein interaction data can provide a more comprehensive understanding of GET1's role in cellular networks.

When interpreting genetic interaction data for membrane trafficking proteins like GET1, it's important to consider that interactions may reflect direct physical associations, sequential steps in a pathway, or parallel pathways that can compensate for each other. For example, synthetic lethality between GET1 and components of alternative membrane protein insertion pathways might indicate redundant functions.

What strategies can be employed to study the dynamics of GET1-mediated TA protein insertion?

Investigating the dynamic process of GET1-mediated TA protein insertion requires techniques that can capture transient intermediates and temporal aspects of the insertion mechanism. The following methodologies are recommended:

  • Real-time Fluorescence Spectroscopy:

    • Förster Resonance Energy Transfer (FRET) between labeled TA proteins and Get1/2 components

    • Environment-sensitive fluorescent probes that change emission properties upon membrane insertion

    • Single-molecule FRET to observe individual insertion events

  • Time-resolved Cryo-Electron Microscopy:

    • Capture structural snapshots of the insertion process at different time points

    • Visualize conformational changes in Get1/2 during TA protein insertion

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Monitor structural dynamics and conformational changes during the insertion process

    • Identify regions of Get1/2 that undergo structural rearrangements upon interaction with Get3 and TA substrates

  • In vitro Reconstitution with Controlled Kinetics:

    • Rapid mixing experiments with stopped-flow apparatus

    • Temperature-jump techniques to initiate conformational changes

    • ATP hydrolysis-coupled assays to monitor the energetics of the insertion process

  • Live Cell Imaging Approaches:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure mobility of GET components

    • Time-lapse imaging similar to that used for Erd1 studies, which revealed sequential association of trafficking components with cargo proteins

When designing these experiments, researchers should consider the temporal resolution required to capture relevant events. The GET insertion process involves multiple steps, including Get3-TA complex docking to Get1/2, channel opening, TA release, and channel closing, each occurring on different timescales ranging from milliseconds to seconds.

How can dosage suppressor screens be utilized to identify functional partners of GET1?

Dosage suppressor screens represent a powerful genetic approach to identify proteins that can compensate for GET1 dysfunction when overexpressed. This methodology can reveal functional partners, parallel pathways, or downstream effectors of GET1. Based on similar approaches used for Erd1 , researchers should consider the following protocol:

  • Screen Design and Setup:

    • Generate a GET1 mutant strain with a clear phenotype (e.g., growth defect under specific conditions, hypersensitivity to drugs like hygromycin)

    • Transform the mutant with a genomic or cDNA library in a multicopy vector

    • Select transformants that suppress the mutant phenotype

  • Validation of Suppressors:

    • Isolate plasmids from suppressor colonies and retransform into the original mutant to confirm suppression

    • Sequence inserts to identify the suppressing genes

    • Perform drop dilution assays to quantify the degree of suppression

  • Functional Classification of Suppressors:

    • Categorize suppressors based on known functions (e.g., membrane trafficking, protein quality control)

    • Test suppression specificity by introducing suppressors into other related mutants

    • Analyze potential mechanistic connections between suppressors and GET1

  • Mechanistic Follow-up Studies:

    • For suppressors involved in GTPase regulation (like Gyp1 for Erd1), test mutant versions (constitutively active or inactive) to determine the mechanism of suppression

    • Examine physical interactions between suppressors and GET1 through co-immunoprecipitation or proximity labeling

    • Investigate localization patterns of suppressors in wild-type versus GET1 mutant backgrounds

This approach has previously identified components like COG complex subunits (Cog5, Cog7) and regulatory GTPases (Ypt7) as suppressors of trafficking defects , suggesting that similar classes of proteins might functionally interact with the GET pathway.

What are common challenges in reconstituting GET1 in membrane systems and how can they be addressed?

Reconstitution of membrane proteins like GET1 into artificial membrane systems presents several technical challenges that can affect experimental outcomes. Here are the major challenges and recommended solutions:

  • Protein Orientation in Liposomes:

    • Challenge: Random orientation of Get1/2 in reconstituted vesicles, with typically only ~18% in the correct orientation .

    • Solutions:

      • Use protease protection assays to quantify orientation

      • Employ asymmetric reconstitution methods (pH gradients or charged lipids)

      • Normalize functional data to the fraction of correctly oriented protein

  • Protein-to-Lipid Ratio Optimization:

    • Challenge: Insufficient or excessive protein density affects channel formation and activity.

    • Solutions:

      • Systematically test multiple protein-to-lipid ratios

      • Use fluorescent lipid dilution assays to monitor incorporation efficiency

      • Verify protein incorporation by sucrose gradient flotation

  • Maintaining Protein Stability During Reconstitution:

    • Challenge: Membrane proteins often denature during detergent removal steps.

    • Solutions:

      • Use mild detergents compatible with the target protein

      • Perform reconstitution at lower temperatures (4°C)

      • Add stabilizing agents (glycerol, specific lipids) during reconstitution

      • Consider detergent-free reconstitution methods using amphipols or nanodiscs

  • Channel Activity Verification:

    • Challenge: Distinguishing specific channel activity from non-specific membrane leakage.

    • Solutions:

      • Include appropriate negative controls (non-channel membrane proteins) and positive controls (established channel proteins like α-hemolysin)

      • Test channel-specific inhibitors or modulators

      • Perform size exclusion experiments with differently sized solutes

  • Heterogeneity in Vesicle Population:

    • Challenge: Variable size and lamellarity of liposomes affecting assay interpretation.

    • Solutions:

      • Use extrusion through defined pore size filters

      • Employ dynamic light scattering to characterize vesicle populations

      • Consider using supported lipid bilayers for more uniform membrane systems

When troubleshooting reconstitution experiments, systematic variation of one parameter at a time while maintaining others constant is recommended to identify optimal conditions for successful GET1 reconstitution and functional analysis.

How should researchers interpret contradictory results when studying GET1 function across different experimental systems?

Contradictory results are common in membrane protein research due to the complexity of these systems and sensitivity to experimental conditions. When facing conflicting data regarding GET1 function, researchers should implement the following structured approach to interpretation:

  • Systematic Comparison of Experimental Conditions:

    • Create a detailed table comparing all experimental variables: expression systems, purification methods, buffer compositions, membrane compositions, and assay conditions

    • Identify parameters that correlate with observed functional differences

  • Validation Through Complementary Techniques:

    • Apply multiple independent methods to assess the same functional property

    • For example, channel activity can be assessed through conductance measurements, fluorescence-based permeability assays, and structural studies

  • Species-Specific Considerations:

    • When comparing Y. lipolytica GET1 with orthologs from other species, analyze sequence conservation in functional domains

    • Consider evolutionary adaptations that might lead to genuine functional differences between species

  • Statistical Analysis and Experimental Design Evaluation:

    • Reassess the experimental design for potential biases or confounding variables

    • Ensure sufficient replication (biological and technical) for statistical validity

    • Consider whether differences reach statistical significance under proper analysis

  • Resolution Strategies for Contradictory Data:

    • Develop hypotheses that could explain the contradictions (e.g., post-translational modifications, cofactor requirements)

    • Design experiments specifically to test these hypotheses

    • Consider context-dependent functions (e.g., GET1 might behave differently under stress conditions)

  • Collaborative Verification:

    • Engage with other laboratories to independently reproduce key experiments

    • Exchange materials (plasmids, strains, antibodies) to eliminate reagent-specific variables

Remember that experimental design and analysis are inseparable . If experiments are not well designed, the validity of statistical inferences may be questionable. Properly designed experiments with appropriate controls and randomization are essential for resolving apparent contradictions in GET1 function.

What quality control parameters should be monitored when working with recombinant Y. lipolytica GET1?

Ensuring the quality and functionality of recombinant Y. lipolytica GET1 is crucial for obtaining reliable experimental results. The following quality control parameters should be routinely monitored:

  • Protein Purity and Integrity:

    • SDS-PAGE with Coomassie staining (aim for >90% purity)

    • Western blotting with GET1-specific antibodies

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

    • N-terminal sequencing to verify the absence of proteolysis

  • Protein Folding and Stability:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Thermal shift assays to determine protein stability in different buffer conditions

    • Limited proteolysis to evaluate the compactness of the folded structure

    • Fluorescence spectroscopy to monitor tertiary structure (if tryptophan residues are present)

  • Membrane Incorporation Efficiency:

    • Flotation assays to quantify protein association with liposomes

    • Freeze-fracture electron microscopy to visualize protein distribution in membranes

    • Protease protection assays to determine orientation in reconstituted systems

    • Dynamic light scattering to monitor liposome size distribution before and after protein incorporation

  • Functional Activity Assessments:

    • Get3 binding assays (e.g., pull-down or surface plasmon resonance)

    • Channel conductance measurements in reconstituted systems

    • TA protein insertion assays using fluorescently labeled substrates

    • ATP hydrolysis assays to monitor the coupling between Get3 ATPase activity and insertion events

  • Batch-to-Batch Consistency:

    • Maintain detailed records of expression conditions, purification parameters, and functional assay results

    • Establish internal standards for comparing new preparations with previous batches

    • Develop quantitative criteria for accepting or rejecting protein preparations

For long-term storage, stability studies should be conducted to determine optimal conditions (temperature, buffer composition, additives) that maintain GET1 functionality. Given the challenges of membrane protein work, it is advisable to use freshly prepared protein whenever possible for critical experiments.

What emerging technologies show promise for advancing our understanding of GET1 function?

Several cutting-edge technologies are poised to significantly advance our understanding of GET1 function in Y. lipolytica and other organisms:

  • Cryo-Electron Microscopy at Atomic Resolution:

    • Recent advances in cryo-EM now allow visualization of membrane protein complexes at near-atomic resolution

    • Application to the Get1/2 complex could reveal the structural basis of channel formation and dynamics

    • Time-resolved cryo-EM could capture different conformational states during the insertion process

  • Integrative Structural Biology Approaches:

    • Combining X-ray crystallography, cryo-EM, NMR spectroscopy, and computational modeling

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes during substrate processing

    • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces between GET pathway components

  • Advanced Membrane Mimetics:

    • Nanodiscs with defined lipid compositions to study lipid-protein interactions

    • Droplet interface bilayers for high-throughput electrophysiological measurements

    • Microfluidic systems for precise control of membrane environments

  • Genome Engineering and High-throughput Screening:

    • CRISPR-Cas9 approaches for precise genome editing in Y. lipolytica

    • Deep mutational scanning to comprehensively map structure-function relationships

    • Synthetic genetic array analysis to systematically identify genetic interactions

  • Single-Molecule Techniques:

    • Single-molecule FRET to observe conformational dynamics during insertion

    • Optical tweezers to measure forces involved in membrane protein insertion

    • Super-resolution microscopy to visualize GET pathway components in cellular contexts

  • AI-Driven Structural Prediction and Analysis:

    • AlphaFold2 and similar tools for predicting protein structures and complexes

    • Machine learning approaches for analyzing complex datasets from genetic screens

    • Molecular dynamics simulations to model channel dynamics and substrate interactions

The integration of these technologies promises to provide unprecedented insights into the structural dynamics and functional mechanisms of the GET pathway, potentially revealing novel therapeutic targets or biotechnological applications.

How might research on Y. lipolytica GET1 contribute to biotechnological applications?

Research on Y. lipolytica GET1 has significant potential to impact various biotechnological applications, particularly given this yeast's established importance in industrial settings:

  • Enhanced Heterologous Protein Production:

    • Optimization of the GET pathway could improve secretion or membrane integration of industrially relevant proteins

    • Y. lipolytica is already recognized for its potential in protein secretion and as a cell factory

    • Engineering GET1 could enhance the production of membrane proteins or proteins requiring membrane translocation

  • Biomembrane Technology Development:

    • The hydrophilic channel formed by Get1/2 could serve as a template for designing synthetic membrane pores

    • Applications in biosensors, drug delivery systems, or nanoreactors

    • Development of membrane protein insertion systems for synthetic biology applications

  • Metabolic Engineering of Y. lipolytica:

    • Y. lipolytica is an oleaginous yeast with applications in lipid production

    • Understanding how GET1 and membrane protein trafficking affect lipid metabolism could lead to strains with enhanced lipid production capabilities

    • Engineering the membrane protein landscape could optimize cellular compartmentalization for metabolic pathways

  • Protein Therapeutics Production:

    • Y. lipolytica has GRAS status, making it suitable for producing therapeutic proteins

    • Enhanced understanding of GET1-mediated membrane protein insertion could improve production of challenging therapeutic targets like GPCRs or ion channels

    • Development of strains with optimized GET pathways for specific therapeutic protein classes

  • Bioremediation Applications:

    • Engineering membrane transporters inserted via the GET pathway for enhanced uptake of environmental pollutants

    • Development of whole-cell biosensors with membrane-integrated sensing components

    • Creation of robust Y. lipolytica strains for environmental applications

The fundamental knowledge gained from studying GET1 in Y. lipolytica could thus translate into practical biotechnological innovations, particularly for applications requiring efficient membrane protein production or manipulation of cellular compartmentalization.

Experimental Design Table for GET1 Research

Experimental ApproachApplication to GET1 ResearchKey ControlsData Analysis MethodExpected Outcomes
Reconstitution in LiposomesChannel activity measurementNon-channel proteins (tSNARE) as negative control; α-hemolysin as positive control Fluorescence quenching kinetics analysisQuantification of channel conductance and gating properties
Site-directed MutagenesisStructure-function analysis of channel-forming residuesWild-type GET1 as reference; conservative and non-conservative mutationsComparative functional assays with statistical significance testingIdentification of critical residues for channel formation and activity
Co-immunoprecipitationIdentification of GET1 interaction partnersNon-specific IgG controls; lysates from GET1-deleted strainsMass spectrometry and interaction network analysisMapping of physical interaction network for GET1
Genetic Interaction ScreensIdentification of functional relationshipsSingle mutant controls; unrelated gene mutations as specificity controlsSAFE and PSN analysis Positioning GET1 in cellular functional networks
Fluorescence MicroscopyLocalization and trafficking dynamicsCo-localization with known organelle markersQuantitative image analysis with tracking algorithmsSpatio-temporal dynamics of GET1 during TA protein insertion

This table provides a framework for designing rigorous experiments to investigate various aspects of GET1 function, ensuring appropriate controls and analysis methods for reliable data interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.