Recombinant Yarrowia lipolytica High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format preference, please include a note with your order, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
SHO1; YALI0D04048g; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
SHO1
Target Protein Sequence
MRQPFSYRPQFQLGLLMGDPFALSTISLGIIGWIIALGGSIGASDQFKNFGWWGLAFEFF VILCVFLVVATDSVEPYRQMLLAFLALATMYVTNSTNNVVYNGTSASSASGAGHILLSII NFLWMIYFGTTHEAGIHAWVDSFAADKGHSYNNDQFAMRRSNPFSLHDQQRQSLGVPGRP VSAYSAGMGGVANYNGLQLGGFENSSNAEPHQASPAFSQQQQQQTATPQQATDSLFVATE YPYRARAVYAYQANPEDANEISFDKGEILDVSDISGRWWQARRDNGEIGICPSNYVELLA
Uniprot No.

Target Background

Function
SHO1 is a plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Y. lipolytica SHO1 protein?

Y. lipolytica High Osmolarity Signaling Protein SHO1 is a 300-amino acid transmembrane protein that likely contains four transmembrane domains, similar to its counterparts in other yeast species. The protein's structure suggests it functions as a membrane-anchored sensor that can detect changes in osmotic conditions. Based on studies in other yeasts, SHO1 likely participates in the High Osmolarity Glycerol (HOG) pathway, which is essential for adaptation to hyperosmotic stress .

How does SHO1 function as an osmosensor?

In Saccharomyces cerevisiae, SHO1 functions as an osmosensor in the HKR1 sub-branch of the HOG pathway. When exposed to high osmolarity conditions, SHO1's transmembrane domains undergo conformational changes that trigger binding to cytoplasmic adaptor proteins, particularly Ste50. This interaction initiates a signaling cascade that ultimately activates the Hog1 MAPK, coordinating cellular adaptation to osmotic stress. While not directly confirmed in Y. lipolytica, the high conservation of osmosensing mechanisms suggests a similar role, warranting experimental validation through mutational analyses and protein interaction studies .

What expression systems are suitable for producing recombinant Y. lipolytica SHO1?

For the expression of recombinant Y. lipolytica SHO1, E. coli has been successfully employed as a host system. The full-length protein (1-300 amino acids) with an N-terminal His-tag has been successfully expressed in E. coli, suggesting this is a viable approach for obtaining research quantities of the protein. When designing expression constructs, researchers should consider codon optimization for the host system to enhance expression levels. Alternative eukaryotic expression systems may be considered if proper folding of transmembrane domains proves challenging in prokaryotic hosts .

What are the optimal conditions for handling and storing recombinant Y. lipolytica SHO1?

ParameterSpecificationMethodological Notes
FormLyophilized powderBrief centrifugation prior to opening is recommended
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add water gradually with gentle mixing
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Provides stability during storage
Long-term Storage-20°C/-80°C with 5-50% glycerol (final)50% glycerol recommended as default
Working Storage4°C for up to one weekFor active experiments
Critical PrecautionAvoid repeated freeze-thaw cyclesAlways prepare working aliquots

Following these specifications is essential for maintaining protein stability and functionality for experimental use. For experiments requiring native conformation, researchers should verify proper folding using circular dichroism or limited proteolysis .

What techniques are most effective for studying SHO1 protein-protein interactions?

Several complementary approaches are recommended for investigating SHO1 interactions:

  • Co-immunoprecipitation using anti-His antibodies (for the tagged recombinant protein) under various osmotic conditions to capture physiologically relevant interactions. This approach has successfully identified osmostress-induced interactions between SHO1 and Ste50 in S. cerevisiae .

  • Chemical crosslinking combined with mass spectrometry to identify transient interactions and map interaction interfaces. This method was instrumental in determining SHO1's oligomeric structure in S. cerevisiae .

  • Split-ubiquitin yeast two-hybrid assays, specifically designed for membrane proteins, to screen for novel interaction partners.

  • Bioluminescence/Förster Resonance Energy Transfer (BRET/FRET) to monitor interactions in real-time under changing osmotic conditions.

Each technique offers complementary information, and researchers should consider using multiple approaches to build a comprehensive interaction map.

How does SHO1 oligomerization contribute to its function?

In S. cerevisiae, SHO1 forms complex oligomeric structures essential for both osmosensing and scaffolding functions. The protein organizes into planar oligomers with a dimers-of-trimers architecture, dimerizing at the TM1/TM4 interface and trimerizing at the TM2/TM3 interface. This sophisticated arrangement enables SHO1 to serve dual functions: sensing osmotic changes through transmembrane domain rearrangements and scaffolding multiple signaling components to facilitate efficient signal transduction .

To investigate whether Y. lipolytica SHO1 forms similar oligomeric structures, researchers should employ:

  • Site-specific crosslinking with strategically placed cysteine residues to map interaction interfaces

  • Blue native PAGE to analyze native oligomeric states

  • Size exclusion chromatography combined with multi-angle light scattering to determine oligomer size and composition

  • Functional assays with mutations targeting potential oligomerization interfaces

These approaches would reveal the relationship between oligomeric structure and function in Y. lipolytica SHO1.

How can researchers effectively study conformational changes in SHO1 during osmotic stress?

To capture the dynamic conformational changes that occur in SHO1 during osmotic stress, researchers should implement multiple complementary biophysical techniques:

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to measure distance changes between specific regions of the protein

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility upon osmotic stress

  • Intramolecular FRET sensors with fluorophores positioned at key locations to detect domain movements in real-time

  • Protease accessibility assays to identify regions with altered exposure during conformational changes

  • Molecular dynamics simulations informed by experimental constraints to model the conformational transitions at atomic resolution

These methods should be applied under precisely controlled osmotic conditions, comparing normal and stress states to correlate structural changes with functional outcomes.

What is the relationship between SHO1 and the HOG pathway in Y. lipolytica?

While specific details about the HOG pathway in Y. lipolytica are not extensively documented in the search results, comparative genomics suggests conservation of this essential stress response pathway across yeast species. In S. cerevisiae, SHO1 functions specifically in the HKR1 sub-branch of the HOG pathway, where it activates the Ste20–Ste11–Pbs2–Hog1 kinase cascade in response to hyperosmolarity .

To characterize the Y. lipolytica HOG pathway and SHO1's role within it, researchers should:

  • Identify Y. lipolytica homologs of known HOG pathway components through bioinformatic analyses

  • Generate knockout strains for SHO1 and other pathway components to assess their contributions to osmotic stress tolerance

  • Perform phosphoproteomic analyses to map signaling events downstream of SHO1 activation

  • Use transcriptomic approaches to identify genes regulated by the HOG pathway under SHO1-dependent and independent conditions

  • Conduct epistasis analyses by creating double mutants to establish the hierarchical organization of pathway components

These approaches would establish whether Y. lipolytica utilizes SHO1 in a manner similar to S. cerevisiae or has evolved distinct regulatory mechanisms.

How does SHO1 function relate to transcription factor networks in Y. lipolytica?

Y. lipolytica contains approximately 140 transcription factors (TFs), several of which have been implicated in stress responses. For instance, Skn1 (YALI0D14520) enhances recombinant protein synthesis capacity under heavy osmotic stress . The relationship between SHO1 signaling and these TF networks represents an important research area.

To investigate these connections, researchers should:

  • Perform transcriptome analysis comparing wild-type and SHO1 deletion strains under osmotic stress to identify TFs whose expression is SHO1-dependent

  • Use chromatin immunoprecipitation sequencing (ChIP-seq) to identify binding sites of stress-responsive TFs in the presence and absence of functional SHO1

  • Create double mutants of SHO1 and key TFs to identify genetic interactions and pathway relationships

  • Analyze promoter regions of SHO1-regulated genes for enrichment of specific TF binding motifs

These approaches would help construct a regulatory network model connecting SHO1 signaling to transcriptional outputs via specific TFs.

What is the relationship between SHO1 and recombinant protein production in Y. lipolytica?

Y. lipolytica has emerged as a promising host for recombinant protein production, with recent developments enhancing its industrial applications . While a direct connection between SHO1 and recombinant protein production is not established in the search results, the protein's role in osmotic stress response likely influences protein synthesis and secretion pathways.

Researchers interested in this relationship should:

  • Compare recombinant protein yields in wild-type, SHO1-deficient, and SHO1-overexpressing strains under various production conditions

  • Analyze how osmotic stress affects protein folding and secretion in the presence and absence of functional SHO1

  • Investigate whether engineering SHO1 or its downstream pathways can enhance recombinant protein production capacity

  • Examine potential crosstalk between SHO1 signaling and unfolded protein response (UPR) pathways, as UPR regulator Hac1 has been identified as a helper factor for enhancing recombinant protein yields

This research direction could lead to novel strategies for improving Y. lipolytica as a protein production platform.

How might SHO1 contribute to Y. lipolytica's adaptation to industrial bioprocessing conditions?

Y. lipolytica shows promise for industrial applications, including the detoxification of cyanogenic glycosides from edible plants . Industrial bioprocessing subjects cells to various stresses, including osmotic fluctuations that would activate SHO1-dependent pathways.

To investigate SHO1's contribution to industrial stress adaptation, researchers should:

  • Characterize SHO1 function under specific industrial conditions (varying pH, temperature, substrate concentrations, and toxic compounds)

  • Engineer SHO1 variants with altered sensitivity or response dynamics to optimize stress adaptation for specific bioprocesses

  • Integrate SHO1 modification with other stress-responsive pathways to develop comprehensively stress-resistant industrial strains

  • Monitor metabolic flux changes mediated by SHO1 signaling during industrial bioprocessing to identify rate-limiting steps

This knowledge could lead to the development of robust Y. lipolytica strains optimized for specific industrial applications, potentially improving process efficiency and product yields.

How has SHO1 function evolved across different yeast species?

Understanding the evolutionary trajectory of SHO1 across yeast species can provide insights into conserved functional aspects versus species-specific adaptations. While the search results don't provide direct comparative information, this represents an important research direction.

Researchers should approach this question through:

  • Phylogenetic analysis of SHO1 sequences from diverse yeasts, identifying conserved domains and species-specific variations

  • Heterologous expression studies where Y. lipolytica SHO1 is expressed in S. cerevisiae sho1Δ strains (and vice versa) to test functional conservation

  • Comparative analysis of SHO1 interaction networks across species to determine conservation of signaling architectures

  • Creation of chimeric SHO1 proteins combining domains from different species to identify functionally critical regions

These approaches would reveal whether Y. lipolytica SHO1 has evolved unique functional properties compared to other yeast species, potentially reflecting adaptation to its specific ecological niche.

What can comparative genomics tell us about HOG pathway architecture in Y. lipolytica?

Comparative genomic analysis of HOG pathway components across yeast species can provide insights into the conservation and divergence of osmotic stress response mechanisms. In S. cerevisiae, the HOG pathway consists of two branches: the SLN1 branch and the SHO1 branch (which itself contains HKR1 and MSB2 sub-branches) .

To characterize the HOG pathway architecture in Y. lipolytica, researchers should:

  • Identify Y. lipolytica homologs of all known S. cerevisiae HOG pathway components through sequence similarity searches

  • Compare protein domain organizations of these homologs to identify potential functional divergence

  • Analyze synteny of HOG pathway genes to identify potential genome rearrangements affecting pathway organization

  • Perform targeted gene deletions to determine the functional importance of each branch and sub-branch

This comparative approach would establish whether Y. lipolytica utilizes a similar dual-branch HOG pathway architecture or has evolved alternative regulatory mechanisms for osmotic stress response.

How could SHO1 be engineered to enhance Y. lipolytica's stress tolerance for biotechnological applications?

Engineering SHO1 presents opportunities to enhance Y. lipolytica's stress tolerance for biotechnological applications. Based on our understanding of SHO1 function, several engineering strategies can be proposed:

  • Sensitivity tuning: Modifying specific residues in the transmembrane domains could alter the protein's threshold for activation, potentially creating strains that respond more efficiently to subtle osmotic changes

  • Response dynamics engineering: Altering the kinetics of SHO1 activation and deactivation could optimize cellular responses to fluctuating conditions in industrial bioprocesses

  • Scaffold optimization: Engineering the oligomeric interfaces of SHO1 could enhance its ability to nucleate signaling complexes, potentially increasing signaling efficiency

  • Cross-pathway integration: Creating chimeric versions of SHO1 that integrate signals from multiple stress types could develop strains with broad stress tolerance

To evaluate these engineered variants, researchers should perform comprehensive phenotypic characterization, including growth under various stress conditions, metabolic profiling, and recombinant protein production capacity assessment.

What novel analytical techniques could advance our understanding of SHO1 dynamics in living cells?

Several cutting-edge analytical techniques could provide unprecedented insights into SHO1 dynamics in living Y. lipolytica cells:

  • Lattice light-sheet microscopy with adaptive optics to visualize SHO1 distribution and dynamics with minimal phototoxicity and high spatiotemporal resolution

  • Single-molecule tracking with photoactivatable fluorescent proteins to monitor SHO1 diffusion, clustering, and interactions in response to osmotic changes

  • Optogenetic tools based on light-sensitive domains fused to SHO1 to enable precise temporal control of its activation for studying downstream signaling kinetics

  • Microfluidic devices coupled with high-speed imaging to expose cells to precisely controlled osmotic shifts while simultaneously monitoring SHO1 responses

  • Genetically encoded biosensors that report on SHO1 conformational states or interactions with downstream effectors in real-time

These technologies would enable researchers to move beyond static, population-averaged measurements to capture the dynamic behavior of individual SHO1 molecules in their native cellular context.

How can systems biology approaches integrate SHO1 function into comprehensive models of Y. lipolytica stress responses?

Systems biology approaches offer powerful frameworks for integrating SHO1 function into comprehensive models of Y. lipolytica stress responses. Researchers should consider:

  • Multi-omics integration: Combining transcriptomics, proteomics, phosphoproteomics, and metabolomics data from wild-type and SHO1 mutant strains under various stress conditions to build comprehensive regulatory networks

  • Mathematical modeling: Developing ordinary differential equation (ODE) models of SHO1 signaling dynamics calibrated with quantitative experimental data

  • Genome-scale metabolic models: Incorporating SHO1-regulated processes into existing Y. lipolytica metabolic models to predict phenotypic outcomes of pathway perturbations

  • Network analysis: Applying graph theory to identify key regulatory hubs and potential points of intervention for strain optimization

  • Machine learning approaches: Training predictive models on multi-dimensional data to identify complex patterns in stress responses that may not be apparent through conventional analyses

These integrated approaches would provide a systems-level understanding of how SHO1 signaling coordinates with other cellular processes to maintain homeostasis under stress conditions.

What resources are available for researchers studying Y. lipolytica SHO1?

Several resources are available to researchers investigating Y. lipolytica SHO1:

  • Recombinant protein: Purified recombinant full-length Y. lipolytica SHO1 protein (1-300aa) with N-terminal His tag is commercially available, suitable for in vitro studies, antibody production, and as experimental controls .

  • Sequence and identifier information:

    • Gene name: SHO1

    • Synonyms: YALI0D04048g; High osmolarity signaling protein SHO1; Osmosensor SHO1

    • UniProt ID: Q6CAC5

  • YaliFunTome database: A searchable repository (https://sparrow.up.poznan.pl/tsdatabase/) containing phenotypic data for Y. lipolytica strains overexpressing various transcription factors under different environmental conditions .

  • Y. lipolytica genome resources: Complete genome sequences and annotations that facilitate identification of pathway components and regulatory elements.

These resources provide essential starting points for experimental design and comparative analyses in SHO1 research.

What methodological challenges should researchers anticipate when studying membrane proteins like SHO1?

Researchers studying membrane proteins like SHO1 should anticipate several methodological challenges:

  • Protein solubilization and purification: Maintaining native conformations of transmembrane domains during extraction from membranes requires careful optimization of detergents or nanodiscs.

  • Functional reconstitution: For in vitro studies, reconstituting SHO1 into artificial membrane systems that maintain functionality presents technical challenges.

  • Structural determination: Obtaining high-resolution structural information for membrane proteins with multiple transmembrane domains requires specialized approaches like cryo-electron microscopy or X-ray crystallography with lipidic cubic phases.

  • Protein-protein interaction detection: Standard interaction assays may not be optimal for membrane proteins, necessitating specialized approaches like split-ubiquitin yeast two-hybrid or in-membrane crosslinking.

  • Live-cell imaging: Visualizing membrane protein dynamics without disrupting function or localization requires careful consideration of tagging strategies and imaging conditions.

Addressing these challenges requires specialized expertise and often adaptation of standard protocols to accommodate the unique properties of membrane proteins.

What experimental controls are essential for SHO1 functional studies?

Robust experimental design for SHO1 functional studies requires several essential controls:

  • For genetic studies:

    • Clean deletion strains (sho1Δ) verified by sequencing

    • Complementation controls with wild-type SHO1 to verify phenotype rescue

    • Empty vector controls for overexpression studies

    • Point mutant controls that selectively disrupt specific functions (e.g., osmosensing vs. scaffolding)

  • For protein interaction studies:

    • Negative controls with unrelated membrane proteins of similar topology

    • Osmotic stress controls (positive and negative) to verify condition-dependent interactions

    • Domain deletion controls to map interaction interfaces

    • Competition assays with purified domains to confirm specificity

  • For signaling pathway studies:

    • Positive controls with known osmotic stress agents at standardized concentrations

    • Time-course measurements to capture signaling dynamics

    • Parallel measurement of multiple pathway components to establish causality

    • Chemical inhibitor controls targeting specific pathway steps

These controls ensure that observed phenotypes are specifically attributable to SHO1 function and help distinguish direct from indirect effects in complex signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.