Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM14 (PAM18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAM18; TIM14; YALI0B12958g; Mitochondrial import inner membrane translocase subunit TIM14; Presequence translocated-associated motor subunit PAM18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
PAM18
Target Protein Sequence
MSTTPVQPLQSEPLMDSETGVAPQIEAPQVPEGPKKGIDEQIFDYFAEHPVQATAATLVG LYALGAVFKRPAAGARGQFFKGGFENKMGPSEALQILSLRDAGLTMNKLKGQHRKIMLLN HPDRGGSPYVATKINEAKSVLEKRGGLK
Uniprot No.

Target Background

Function

Essential component of the PAM complex, crucial for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the matrix. Within the complex, it acts as a stimulator of mtHSP70 (SSC1) activity.

Database Links
Protein Families
TIM14 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is TIM14 (PAM18) and what role does it play in mitochondrial protein import?

TIM14, also known as PAM18, is an essential component of the mitochondrial protein import machinery, specifically functioning within the import motor of the TIM23 complex. It is an integral protein of the inner mitochondrial membrane with a typical J-domain exposed to the matrix space . This J-domain is crucial as it stimulates the ATPase activity of mitochondrial heat shock protein 70 (mtHsp70), enabling the chaperone to act in a rapid and regulated manner in trapping unfolded preproteins entering the matrix . Mitochondria depleted of Tim14 show significant deficiency in protein import mediated by the TIM23 complex, particularly affecting proteins requiring mtHsp70 action . The protein interacts with Tim44 and mtHsp70 in an ATP-dependent manner, forming part of the essential machinery that drives protein translocation into mitochondria .

How is TIM14 structurally organized in the mitochondrial membrane?

TIM14 has a distinctive domain structure with functional significance. It is anchored in the inner mitochondrial membrane by a single transmembrane domain and exposes a conserved C-terminal domain containing the J-domain into the matrix . In yeast TIM14, there is also an N-terminal domain that extends into the intermembrane space, though this region shows less conservation across species . Functional analysis using truncation mutants revealed that deletion of the N-terminal segment had virtually no effect on TIM14 function in yeast, consistent with its limited evolutionary conservation . Interestingly, even the combined deletion of both the intermembrane and transmembrane domains did not severely impact TIM14 functionality, as the conserved matrix domain alone can support cell growth . This indicates that the functional core of TIM14 resides in its matrix-exposed domain containing the J-domain.

Why is Yarrowia lipolytica valuable as a model organism for mitochondrial protein import studies?

Yarrowia lipolytica has emerged as an excellent eukaryotic model system for analyzing mitochondrial processes, including protein import. Unlike conventional yeast models, Y. lipolytica is an obligate aerobic yeast that offers unique advantages for studying respiratory chain components such as complex I . Researchers have established this organism to analyze how human pathogenic mutations in mitochondrial proteins correlate with specific symptom patterns and severity . Y. lipolytica provides several experimental benefits including:

  • Ability to reconstruct patient alleles through site-directed mutagenesis and plasmid complementation

  • Visualization capabilities using fluorescent proteins (eYFP) attached to mitochondrial proteins

  • Creation of deletion strains for nuclear-coded subunits

  • Measurement of catalytic activities, Km values, and inhibitor responses for mitochondrial complexes

These features make Y. lipolytica particularly useful for understanding the molecular basis of mitochondrial disorders and identifying domains critical for protein function .

What is the relationship between TIM14 (PAM18) and TIM16 (PAM16)?

TIM14/PAM18 forms a crucial heterodimeric complex with TIM16/PAM16, a J-like protein partner . While TIM14 contains a functional J-domain that stimulates mtHsp70 ATPase activity, TIM16 possesses a J-like domain that lacks this stimulatory function . The TIM14-TIM16 complex demonstrates reduced ability to stimulate mtHsp70 ATPase activity compared to TIM14 alone, suggesting TIM16 serves as a regulatory element .

Structural studies reveal that the conserved domains of both proteins have virtually identical folds despite limited sequence identity . The interaction interface involves an extended arm region outside TIM14's J-domain, and deletion of this arm abolishes complex formation and TIM14 function . This heterodimer formation is essential for proper mitochondrial protein import, as mutations disrupting this interaction are lethal in yeast .

Thermal stability experiments demonstrate that individually, TIM14 and TIM16 are marginally stable proteins with low melting temperatures (Tm values of 16.5°C and 29°C, respectively), but their heterodimer exhibits significantly greater stability (Tm of ~40°C) . This suggests that heterodimer formation is strongly favored in vivo, with regulation occurring through conformational changes rather than complex dissociation .

How can researchers express and purify recombinant Y. lipolytica TIM14 for functional studies?

Expression and purification of recombinant Y. lipolytica TIM14 requires careful consideration of construct design and protein stability. Based on established protocols, researchers can efficiently obtain this protein through the following methodology:

For soluble domain expression, the sequence encoding amino acid residues 84-169 of TIM14's J-domain can be amplified by PCR and cloned into a modified pET21d vector containing a TEV protease site between the protein and an N-terminal octa-histidine tag . BL21 tuner E. coli strain serves as an effective expression host . The protein can be purified using nickel affinity chromatography followed by tag removal with TEV protease if desired.

For co-expression with TIM16, compatible vectors can be designed to express both proteins simultaneously, with only one containing a histidine tag. The efficient purification of both proteins during isolation indicates stable complex formation . When expressing the TIM14-TIM16 complex, researchers should be aware that individually, these proteins have low thermal stability, so maintaining appropriate buffer conditions is critical .

Specific construct designs that have proven successful include:

DescriptionAmino acids includedAbbreviated name
Soluble domain of Y. lipolytica TIM14/PAM1884-168yTim14s/Pam18s
Full length Y. lipolytica TIM14/PAM181-168yTim14/Pam18
Y. lipolytica TIM14/PAM18 in complex with TIM16/PAM161-168 (TIM14), 1-149 (TIM16)yTim14/Pam18-yTim16/Pam16

These constructs can be stored in Tris-based buffer with 50% glycerol at -20°C, though repeated freezing and thawing should be avoided .

What experimental approaches are most effective for studying TIM14-TIM16 interactions?

Several complementary experimental approaches have proven effective for investigating TIM14-TIM16 interactions:

  • Co-immunoprecipitation (Co-IP): This technique reliably assesses complex formation in isolated mitochondria. Antibodies against either TIM16 or TIM14 can precipitate both proteins from mitochondrial lysates, confirming their interaction . The absence of a protein from the precipitate after specific mutations provides evidence for disrupted complex formation.

  • Crosslinking studies: Using bifunctional reagents such as disuccinimidyl suberate (DSS) allows identification of interaction sites between TIM14 and TIM16 . This approach has been instrumental in mapping the protein-protein interface within the complex.

  • Circular dichroism (CD) spectroscopy: This technique enables analysis of conformational changes and thermal stability. Placing TIM16 in one cell of a tandem cuvette and TIM14 in another allows spectrum measurement before and after mixing, with differences indicating molecular interactions . The increase in negative ellipticity at 222 nm observed after mixing reflects enhanced α-helical content upon complex formation.

  • Thermal stability assays: Comparing melting temperatures of individual proteins versus the complex provides insight into interaction strength. The significant increase in Tm for the TIM14-TIM16 complex (40°C) compared to individual proteins (16.5°C and 29°C) quantifies the stabilization effect of heterodimer formation .

  • In vivo site-specific crosslinking: This advanced approach involves introducing amber stop codons at specific positions and incorporating benzoyl-phenylalanine (BPA) using orthogonal tRNA-synthetase pairs . This enables precise mapping of interaction points in the native cellular environment.

How do mutations in TIM14 affect protein import and cell viability?

Mutations in TIM14, particularly within the conserved J-domain, have profound effects on protein import and cell viability. The most critical region is the HPD motif of the J-domain, which is essential for stimulating mtHsp70 ATPase activity . Mutations in this motif completely abolish TIM14 function as a J-protein and are lethal in yeast cells .

Interestingly, mutations outside the J-domain can also critically impact function. Deletion of the arm region that mediates TIM16 interaction prevents complex formation and has a detrimental effect on TIM14 function, rendering cells inviable . This demonstrates that both J-domain functionality and appropriate complex formation with TIM16 are essential for TIM14's role in mitochondrial protein import.

In cells depleted of TIM14 or expressing non-functional mutants, mitochondrial protein import is severely compromised, particularly for proteins requiring mtHsp70 action . This import deficiency manifests as a lethal phenotype, underscoring TIM14's essential nature in cellular metabolism. Experimental approaches using temperature-sensitive mutants or conditional depletion systems allow researchers to study these effects without immediately killing cells, facilitating detailed analysis of the molecular consequences of TIM14 dysfunction.

What evolutionary insights can be gained from comparing TIM14 across species?

Comparative analysis of TIM14 across species provides valuable evolutionary insights. TIM14 genes are present in virtually all eukaryotic genomes, indicating their ancient evolutionary origin and essential function . Studies comparing human and yeast TIM14/PAM18 reveal significant structural conservation despite sequence divergence.

Human TIM14/PAM18 can form stable complexes with yeast TIM16/PAM16 and vice versa, demonstrating remarkable conservation of interaction interfaces across approximately 1 billion years of evolutionary separation . This cross-species complex formation ability suggests the three-dimensional structure and key interaction surfaces have been strongly preserved throughout eukaryotic evolution.

Domain analysis shows that while the J-domain and adjacent regions mediating TIM16 interaction are highly conserved, the N-terminal domain exposed to the intermembrane space shows less conservation . This aligns with functional studies demonstrating that deletion of this domain has minimal effect on TIM14 function in yeast, supporting the view that evolutionary conservation correlates with functional importance .

These comparative studies contribute to understanding how the mitochondrial import machinery evolved from its endosymbiotic origins and provide insight into the fundamental mechanisms of protein translocation that are conserved from single-celled organisms to humans.

How can Y. lipolytica be optimized as an expression system for recombinant TIM14?

Yarrowia lipolytica offers unique advantages as an expression system for recombinant proteins, including TIM14/PAM18. To optimize expression in this host, researchers should consider:

  • Strain selection: Y. lipolytica strain CLIB 122/E 150 has a well-characterized genome and established genetic tools . This strain provides a reliable platform for recombinant protein expression.

  • Expression construct design: For efficient expression, recombinant TIM14 can be expressed with appropriate tags for purification. The tag type can be determined during the production process based on experimental needs . Incorporating strong promoters and optimized codon usage enhances expression levels.

  • Secretion efficiency: Y. lipolytica possesses unique advantages in nascent protein transport and glycosylation modification . Its secretome is nearly twice that of S. cerevisiae, and its protein sequence in the secretory pathway shows 40% greater similarity to mammals compared to budding yeast . This makes it particularly valuable for expressing proteins requiring sophisticated post-translational modifications.

  • Scale-up considerations: Y. lipolytica can be cultivated in large-scale fermenters, with protocols established for scaling from 3L shake flasks to 50L, 500L, and even 18m³ production volumes . The simpler fermentation process compared to other yeast systems (like Pichia pastoris) offers cost and time savings .

  • Extraction methods: For intracellular proteins like TIM14, extraction by grinding at -20°C with appropriate protease inhibitors yields suitable samples . Extracellular proteins can be collected from fermentation supernatants and concentrated using centrifugal filters with appropriate molecular weight cutoffs .

Y. lipolytica has demonstrated higher yields and activity for various recombinant proteins compared to conventional systems like P. pastoris , making it a promising platform for challenging mitochondrial proteins like TIM14.

What methods can assess the functionality of recombinant TIM14 in mitochondrial import assays?

The functionality of recombinant TIM14 can be rigorously assessed using several complementary approaches:

  • In vivo complementation: A TIM14 shuffling strain (with chromosomal TIM14 deleted and maintained by a wild-type copy on a URA plasmid) allows testing whether recombinant variants can support growth . After introducing plasmids encoding TIM14 variants, growth on 5-FOA medium (which selects against the URA plasmid) reveals functional complementation . Growth can be assessed on both fermentable (YPD) and non-fermentable (YPG or YPLac) carbon sources at varying temperatures.

  • Protein import assays: Isolated mitochondria containing recombinant TIM14 variants can be tested for their ability to import radiolabeled precursor proteins. Import efficiency is measured by protease protection of imported proteins and processing of presequences.

  • ATPase stimulation assays: The ability of recombinant TIM14 to stimulate mtHsp70 ATPase activity can be directly measured and compared to wild-type protein, quantifying the functional capacity of the J-domain.

  • Complex formation analysis: Co-immunoprecipitation experiments determine whether recombinant TIM14 properly interacts with TIM16 and other components of the import machinery. Antibodies against TIM16 should co-precipitate functional TIM14, while mutations disrupting this interaction will show reduced or absent co-precipitation .

  • Crosslinking studies: Site-specific crosslinking using amber stop codons and BPA incorporation allows precise mapping of protein interactions in vivo . This approach can verify whether recombinant TIM14 assumes the correct orientation and proximity to partner proteins.

These methods provide comprehensive assessment of both biochemical activity and biological functionality of recombinant TIM14 variants, ensuring reliable interpretation of experimental results.

How can TIM14 be used to study mitochondrial disease mechanisms?

Yarrowia lipolytica TIM14 provides a valuable model for investigating mitochondrial disease mechanisms through several approaches:

The yeast system allows reconstruction of patient alleles by site-directed mutagenesis and plasmid complementation . For mutations in the TIM14 pathway, researchers can introduce corresponding changes in the yeast protein and analyze effects on mitochondrial function. This approach has successfully characterized pathogenic mutations in related mitochondrial components, revealing decreased catalytic activities, elevated Km values, and altered inhibitor responses .

Disease-relevant mutations in the J-domain or interaction regions can be analyzed for their effects on protein import, providing molecular explanations for pathogenic mechanisms. Similar studies with complex I have identified regions critical for catalysis by mapping Leigh syndrome mutations to domain boundaries .

The relatively simple genetic system of Y. lipolytica facilitates rapid screening of multiple mutations and potential therapeutic interventions. By combining these approaches with structural analysis of the TIM14-TIM16 complex, researchers can develop detailed models of how disease mutations disrupt protein import and identify potential compensatory mechanisms or drug targets.

What role does TIM14 play in the broader context of mitochondrial translocation machinery?

TIM14 functions within a sophisticated network of protein interactions that drive mitochondrial protein import. It forms part of the presequence translocase-associated motor (PAM) complex, which works in concert with the TIM23 core complex to transport proteins into the mitochondrial matrix .

The TIM23 complex consists of membrane-embedded components (including Tim17, Tim23, and Tim50) that form the translocation channel, while the PAM complex (including Tim44, mtHsp70, TIM14/PAM18, TIM16/PAM16, and Mge1) drives protein movement through the channel in an ATP-dependent manner .

TIM14 contributes to this process by stimulating the ATPase activity of mtHsp70 through its J-domain . This stimulation is carefully regulated by TIM14's interaction with TIM16, preventing uncontrolled ATPase activation . The precise coupling of TIM14's activity to the translocation process ensures efficient and regulated protein import.

Research using in vivo site-specific crosslinking has revealed that Tim17, another essential membrane-embedded subunit of the translocase, plays a critical role in coupling the import motor to the translocation channel . This dynamic interaction network ensures that the energy from ATP hydrolysis is effectively harnessed to drive directional protein movement across the membrane.

What transcriptional factors influence recombinant TIM14 expression in Y. lipolytica?

The expression of recombinant proteins, including TIM14, in Yarrowia lipolytica is governed by complex transcriptional regulatory networks that remain partially characterized. Recent studies have begun to elucidate the transcription factors (TFs) that influence recombinant protein synthesis in this organism .

Analysis of RNAseq datasets from Y. lipolytica strains overproducing biochemically different recombinant proteins revealed that of 140 TFs in Y. lipolytica, 87 TF-encoding genes were significantly deregulated in at least one strain . These expression profiles were compared against recombinant protein amounts from 125 strains co-overexpressing TFs and recombinant proteins, providing insights into transcriptional control mechanisms .

Further investigation using TF knockout strains demonstrated varied profiles of transcriptional deregulation and impacts on recombinant protein synthesis, identifying new engineering targets for improved expression . This systems biology approach provides a foundation for rational strain engineering to enhance TIM14 expression.

While specific TF requirements for TIM14 expression weren't detailed in the search results, the general principles of transcriptional regulation in Y. lipolytica can be applied to optimize expression constructs. Strategic manipulation of key TFs could potentially enhance recombinant TIM14 yield and facilitate structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.