Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIM50; YALI0B20856g; Mitochondrial import inner membrane translocase subunit TIM50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-466
Protein Length
Full Length of Mature Protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
TIM50
Target Protein Sequence
SDKKTEKSDQPFQSSLLNDDLLAQAGMDVDESKGKSKPAAEGKSEGAAEGATEDDVTDEQ RARWAGTAKKSTDQTSKQESRERIAGYGYYAFFAGSAAFAAYLARDWDNEEDKKKHDTIG QGYTPMLMWARLKARIGDTFSFYRDPVAPVLLPDPPAPPYQRPLTLVIALDDLLVHQEWS REHGWRVAKRPGVDYFLGYLGQYYEIVLFSSQYMANCEKLIMKLDPYHAWFSHVLTREHT TYEDGKLVKDLSLMNRDMGKIIIIDPDTGCTMKQPENSIPIEPWKGTPGDKELVKLIPFL EWLVSQNVNDVRPILKAFDGTYLPDEFTRREAIAREKFEKDWYAKHGKDGQWASKFLGVS EPKQQKPLMPHDVMRREGQKQYQKFLEYLAVEGPKLKAEEERMIAEQKAMGPKNLSEAVS SIGSLPPVPQQPTEPKA
Uniprot No.

Target Background

Function

TIM50 is a crucial component of the TIM23 complex, responsible for translocating proteins containing transit peptides across the mitochondrial inner membrane. Its function involves guiding preproteins during transit to the TIM23 channel protein. It may also facilitate the transfer of translocating proteins from the TOM complex to the TIM23 complex.

Database Links
Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the structural composition of Yarrowia lipolytica TIM50?

Yarrowia lipolytica TIM50 (referred to as Tim50 in research contexts) is a mitochondrial import inner membrane translocase subunit with a molecular structure consisting of:

  • A transmembrane domain anchoring it to the inner mitochondrial membrane

  • A large intermembrane space (IMS) domain composed of:

    • A core domain

    • A C-terminal presequence-binding domain (PBD) (approximately amino acids 395-476)

    • A functional NIF domain

The protein's amino acid sequence includes conserved regions that are critical for its functionality, particularly in the C-terminal portion which forms a compact folded domain involved in presequence binding .

Tim50's structure enables its dual function in both recognizing presequence-carrying proteins and regulating the Tim23 channel. The protein forms a stable conformation when expressed recombinantly, which is crucial for researchers hoping to utilize it in experimental systems .

What are the primary functions of Tim50 in mitochondrial protein import?

Tim50 serves several essential functions in mitochondrial protein transport:

  • Presequence recognition: The C-terminal presequence-binding domain (PBD) specifically recognizes and binds to N-terminal targeting signals (presequences) of proteins destined for mitochondrial import .

  • Tim23 channel regulation: Tim50 interacts with the Tim23 channel in an antagonistic manner to the presequence, helping regulate channel opening and closing during protein translocation .

  • Early precursor interaction: Tim50 interacts with precursor proteins as they exit the TOM complex, assisting in their transfer across the outer membrane .

  • Essential connector: Tim50 serves as a critical link between the outer membrane translocation (TOM complex) and inner membrane translocation (TIM23 complex) machineries, coordinating protein movement between the two membranes .

These functions collectively make Tim50 indispensable for cell viability, as demonstrated by the lethal phenotype observed in yeast strains with C-terminal deletions of the protein .

What are the optimal conditions for expressing recombinant Yarrowia lipolytica Tim50?

For optimal recombinant expression of Yarrowia lipolytica Tim50, researchers should consider the following protocol:

Expression System Options:

  • E. coli expression: Suitable for producing isolated domains (Tim50 IMS, Tim50 PBD)

  • Yarrowia lipolytica expression: For full-length protein with proper post-translational modifications

Recommended Storage Conditions:

  • Store at -20°C in Tris-based buffer with 50% glycerol

  • For extended storage, maintain at -80°C

  • Avoid repeated freeze-thaw cycles; prepare working aliquots stored at 4°C for up to one week

Expression Vector Considerations:

  • For Y. lipolytica expression, integrative multi-copy expression vectors under the control of strong promoters such as the isocitrate lyase promoter (pICL1)

  • Targeting sequences such as rDNA or the long terminal repeat (LTR) zeta of Ylt1 can be used for efficient integration

  • Selection markers like ura3d4 allow for selection of multi-copy transformants

When expressing the full protein, note that Tim50 is prone to proteolytic cleavage during purification, particularly at the boundary between the core domain and the C-terminal presequence-binding domain, which may yield fragments resembling the Tim50 PBD construct .

What methods are most effective for detecting and verifying TIM50 expression?

Several complementary methods can be employed for robust detection and verification of TIM50 expression:

Western Blotting:

  • Use antibodies specific to TIM50 (commercial antibodies such as sc55338 are available at 1:200 dilution)

  • For tagged versions, anti-HA antibodies can detect HA-tagged Tim50 constructs

  • Purified mitochondria should be used as starting material for optimal detection

Photo-affinity Labeling:

  • Presequence peptides containing photo-reactive amino acids can be used to verify TIM50's presequence-binding functionality

  • Upon UV irradiation, cross-linked adducts form between TIM50 and presequence probes

  • Cross-linked products can be analyzed by SDS-PAGE followed by Western blotting

Mass Spectrometric Analysis:

  • LC MALDI MS/MS analysis can definitively identify TIM50 and map photo-adducts to specific domains

  • This approach is particularly useful for identifying interaction sites within the protein

Functional Verification:

  • In vitro import assays using radiolabeled precursor proteins can confirm functional activity

  • Complementation assays in yeast strains with TIM50 under control of regulatable promoters

For recombinant Y. lipolytica TIM50, expression verification should be performed at both the protein level (using the methods above) and at the genomic level using Southern blotting to confirm the integration of expression cassettes into the genome .

How can Tim50 be used as a tool to study mitochondrial protein import mechanisms?

Tim50 serves as a powerful research tool for investigating various aspects of mitochondrial protein import:

Presequence Recognition Studies:

  • Purified Tim50 PBD can be used in binding assays with synthetic presequence peptides to study specificity determinants

  • Photo-reactive presequence probes enable mapping of interaction surfaces through cross-linking and mass spectrometry

Translocation Intermediate Analysis:

  • Tim50 can be used to trap translocation intermediates, allowing researchers to dissect the step-by-step process of protein import

  • Site-specific cross-linking between Tim50 and precursor proteins reveals the path taken by imported proteins

TOM-TIM23 Complex Interactions:

  • Tim50's function in coordinating transport between the outer and inner membranes makes it valuable for studying the "hand-off" of precursors between translocases

  • Truncated variants lacking specific domains help define the regions required for different steps of the process

Structure-Function Analysis:

  • Through systematic mutagenesis of conserved residues in Tim50, researchers can determine critical amino acids for presequence binding and Tim23 interaction

  • The essential nature of Tim50 allows for selection schemes to identify functional variants

A systematic approach employing both in vitro reconstitution experiments with purified components and in organello assays using isolated mitochondria can provide complementary insights into Tim50's role in the complex protein import machinery .

What are the key experimental controls needed when studying TIM50 function in presequence binding?

When investigating TIM50's presequence binding function, several critical controls should be implemented:

Protein Domain Controls:

  • Positive control: Full-length Tim50 IMS domain should demonstrate presequence binding

  • Negative control: Tim50 ΔPBD (lacking the C-terminal presequence-binding domain) should show significantly reduced or absent presequence binding

  • Specificity control: Non-mitochondrial proteins with similar properties should not bind presequences

Peptide Specificity Controls:

  • Active presequences: Use well-characterized mitochondrial presequences like Cox4

  • Inactive peptides: SynB2 or scrambled presequence peptides should not show significant binding

  • Competition assays: Unlabeled presequences should compete with labeled ones for binding sites

Methodological Controls for Cross-linking Experiments:

  • UV-dependence: No cross-linking should occur in the absence of UV irradiation for photo-reactive probes

  • Concentration dependence: Cross-linking efficiency should correlate with probe concentration

  • Chemical cross-linking validation: Alternative approaches like using homo-bifunctional reagents (DFDNB) should corroborate photo-cross-linking results

Functional Validation:

  • Import competition: Presequence peptides should inhibit import of presequence-containing precursors in a concentration-dependent manner

  • Membrane potential controls: Dissipating the membrane potential with ionophores (1 μM valinomycin, 8 μM antimycin A, and 20 μM oligomycin) should block import regardless of TIM50 function

These controls ensure that observed effects are specifically due to the presequence-binding activity of TIM50 rather than non-specific interactions or experimental artifacts .

What are common challenges in purifying functional recombinant Tim50 and how can they be addressed?

Researchers face several challenges when purifying functional recombinant Tim50:

Challenge: Proteolytic Degradation

  • Solution: Add protease inhibitors during all purification steps

  • Approach: Consider expressing and purifying individual domains separately (e.g., Tim50 PBD) which form stable, compact structures less susceptible to proteolysis

  • Alternative: Use mass spectrometry to identify proteolytic cleavage sites and engineer constructs with modified sequences at these sites

Challenge: Maintaining Native Conformation

  • Solution: Optimize buffer conditions (50% glycerol stabilizes the protein)

  • Approach: Use circular dichroism or limited proteolysis to verify proper folding

  • Storage: Maintain purified protein at -20°C for short-term or -80°C for long-term storage

Challenge: Low Expression Yields

  • Solution: For Y. lipolytica expression, use integrative multi-copy vectors with ura3d4 selection marker

  • Approach: Optimize codon usage for the expression host

  • Alternative: Consider diploidization strategies to increase gene copy number and expression levels

Challenge: Assessing Functionality

  • Solution: Develop robust functional assays such as presequence peptide binding

  • Approach: Use photo-affinity labeling with presequence probes to verify binding activity

  • Validation: Test the ability of purified Tim50 to restore import in Tim50-depleted mitochondria

Challenge: Solubility Issues

  • Solution: Express only the soluble intermembrane space domain (Tim50 IMS) for in vitro studies

  • Approach: Test different fusion tags (His, GST, MBP) to enhance solubility

  • Alternative: Explore detergent conditions for full-length protein solubilization

Addressing these challenges requires a combinatorial approach, often necessitating modifications to expression constructs, purification protocols, and functionality assays.

How can researchers distinguish between direct and indirect effects when studying TIM50 deficiency phenotypes?

Distinguishing between direct and indirect effects of TIM50 deficiency requires a multi-faceted approach:

Temporal Analysis:

  • Acute depletion models: Using regulated promoters (e.g., GAL1) to control TIM50 expression allows researchers to observe immediate effects before secondary consequences develop

  • Time-course experiments: Monitor changes in mitochondrial function, protein import efficiency, and cellular phenotypes at multiple time points after TIM50 depletion

Domain-Specific Mutations:

  • Targeted mutations: Introduce specific mutations in different functional domains of TIM50 (e.g., Tim23-binding region vs. presequence-binding domain)

  • Separation-of-function mutants: Identify variants that affect one function while preserving others to dissect the primary cause of observed phenotypes

Rescue Experiments:

  • Domain complementation: Test whether individual domains can rescue specific aspects of the phenotype

  • Heterologous protein expression: Determine if TIM50 homologs from other species can complement deficiency

In Vitro Reconstitution:

  • Purified component assays: Reconstitute specific functions with purified components to establish direct biochemical relationships

  • Stepwise addition: Add components sequentially to identify the minimal system required for function

Multi-omics Approach:

  • Proteomics: Analyze changes in the mitochondrial proteome to identify the most rapidly affected proteins

  • Metabolomics: Monitor metabolic alterations to distinguish between primary bioenergetic defects and secondary adaptations

  • Transcriptomics: Examine transcriptional responses to differentiate direct effects from compensatory mechanisms

An example from cardiac research demonstrates how combining genetic models (TIM50 knockout mice and cardiac-specific overexpression mice) with multiple analytical techniques (echocardiography, histological analysis, Western blot, and real-time PCR) can help establish causality in TIM50-related phenotypes .

How does Yarrowia lipolytica Tim50 compare functionally to homologs from other yeast species?

Comparative analysis of Tim50 across yeast species reveals important functional conservation and species-specific adaptations:

Functional Conservation:

  • Core mechanism: Tim50's role as a presequence receptor and Tim23 channel regulator is conserved across yeast species

  • Essential nature: Tim50 is essential for viability in both fermentative yeasts (S. cerevisiae) and strictly aerobic yeasts (Y. lipolytica)

  • Domain organization: The presence of a C-terminal presequence-binding domain is preserved across species

Species-Specific Differences:

  • Metabolic context: Y. lipolytica is a strictly aerobic yeast that cannot survive without functional mitochondria, unlike S. cerevisiae which can grow fermentatively

  • "Petite-negative" phenotype: Y. lipolytica cannot tolerate loss of mitochondrial DNA, making mitochondrial protein import even more critical

  • Evolutionary position: Y. lipolytica belongs to basal lineages of hemiascomycetes, providing insights into ancient features of mitochondrial import machinery

Structural Adaptations:

  • The presequence-binding domain shows conservation of hydrophobic interaction surfaces, though specific amino acid composition may vary

  • Differences in Tim50-Tim23 interactions may reflect adaptations to species-specific mitochondrial membrane compositions

  • Y. lipolytica Tim50 may have evolved specific features to support the obligate aerobic lifestyle of this organism

Research Implications:

  • Y. lipolytica serves as an excellent model for studying essential mitochondrial functions due to its aerobic nature

  • Comparative studies between Y. lipolytica and S. cerevisiae Tim50 can highlight adaptations specific to different metabolic strategies

  • The haploid propagation capability of Y. lipolytica facilitates phenotypic analysis of genetic modifications

This comparative perspective is particularly valuable for understanding fundamental versus specialized aspects of mitochondrial protein import across evolutionary diverse organisms.

What experimental considerations differ when studying recombinant Tim50 versus endogenous Tim50?

Researchers should account for several key differences when studying recombinant versus endogenous Tim50:

Experimental Parameter Differences:

ParameterRecombinant Tim50Endogenous Tim50Experimental Implications
Protein concentrationOften higher than physiologicalMaintained at native levelsMay affect interaction kinetics and detection sensitivity
Post-translational modificationsMay be absent or differentNative modifications preservedCould alter function, stability, or interactions
Protein contextIsolated protein or domainIntegrated in TIM23 complexImpacts functional relevance of observed interactions
Structural integrityPotential misfolding issuesNative conformationAffects interpretation of binding and functional studies
Associated factorsAbsent unless reconstitutedNatural binding partners presentInfluences observed activity and regulation

Methodological Adaptations:

For Recombinant Studies:

  • Validate proper folding using biophysical techniques

  • Include controls for tag interference if fusion proteins are used

  • Consider reconstitution with known binding partners

  • Test functionality through complementation of Tim50-depleted systems

For Endogenous Studies:

  • Develop highly specific antibodies for detection and immunoprecipitation

  • Use conditional expression systems for depletion studies

  • Consider the context of the TIM23 complex and associated components

  • Account for differences between in vitro and in organello conditions

Integration Approach:
The most robust research strategies combine recombinant protein studies with in organello experiments. For example, researchers have:

  • Identified the presequence-binding domain using recombinant proteins

  • Confirmed the domain's relevance by creating truncated variants in yeast

  • Verified that the phenotypes are specifically due to impaired presequence binding rather than general structural defects

This integrated approach balances the controlled environment of recombinant studies with the physiological relevance of endogenous contexts.

How can Tim50 research inform the development of mitochondrial targeting strategies for therapeutic purposes?

Tim50's central role in mitochondrial protein import offers several avenues for developing mitochondrial targeting strategies:

Presequence Engineering:

  • Tim50's specific recognition of presequences can be leveraged to design optimized targeting signals for therapeutic cargo

  • Structure-activity studies of presequence-Tim50 interactions inform the design of synthetic presequences with enhanced binding properties

  • The essential nature of the presequence-Tim50 interaction provides a reliable entry route into mitochondria

Mitochondrial Disease Models:

  • Recent studies on TIMM50 disease-causing mutations in human fibroblasts revealed significant decreases in TIM23 core proteins

  • These models can help screen potential therapeutics targeting mitochondrial protein import defects

  • Understanding how TIM50 deficiency affects cellular functions provides insights into pathogenic mechanisms

Cardioprotective Applications:

  • TIM50 has been identified as a protective factor against cardiac hypertrophy

  • Expression levels of TIM50 are downregulated in hypertrophic hearts

  • This suggests potential therapeutic strategies involving TIM50 modulation for heart disease

  • Genetic approaches (overexpression) have demonstrated protective effects in animal models

Therapeutic Delivery Systems:

  • Knowledge of Tim50-presequence interactions could inform the development of mitochondria-targeted drug delivery systems

  • Conjugating therapeutic molecules to optimized presequences may enhance their delivery to mitochondria

  • Structural studies of the presequence-binding domain provide a foundation for rational design of targeting moieties

Preclinical Research Directions:

  • Development of small molecules that modulate Tim50-presequence interactions

  • Engineering of recombinant proteins with optimized mitochondrial targeting signals

  • Gene therapy approaches to correct TIMM50 mutations or modulate expression levels in disease states

The translational potential of Tim50 research is particularly promising for diseases involving mitochondrial dysfunction, including cardiomyopathies, neurodegenerative disorders, and inherited mitochondrial diseases.

What are the methodological considerations when studying Tim50's role in coordinating protein transport across both mitochondrial membranes?

Investigating Tim50's coordinating function between the two mitochondrial membranes requires specialized experimental approaches:

Reconstitution of TOM-TIM23 Supercomplex:

  • Develop purification strategies that maintain interactions between TOM and TIM23 complexes

  • Use gentle solubilization conditions with appropriate detergents or nanodiscs

  • Employ chemical cross-linking to stabilize transient interactions between complexes

  • Analyze resulting supercomplexes by blue native PAGE and mass spectrometry

In Vitro Transport Assays:

  • Design assays with purified outer membrane vesicles (OMVs) and inner membrane vesicles (IMVs)

  • Use recombinant Tim50 to bridge these compartments and monitor precursor transfer

  • Measure transfer efficiency using fluorescently labeled precursors or enzymatic reporters

  • Compare wild-type Tim50 with domain-specific mutants to map functional regions

Structural Analysis Approaches:

  • Employ cryo-electron microscopy to visualize the TOM-TIM23 interface

  • Use cross-linking mass spectrometry (XL-MS) to map contact sites between Tim50 and components of both translocases

  • Develop in situ structural techniques to preserve native membrane architecture

Kinetic Analysis:

  • Measure kinetics of precursor handover between TOM and TIM23 complexes

  • Determine rate-limiting steps in the transport process

  • Assess how Tim50 domains influence these kinetics

  • Compare results in reconstituted systems versus intact mitochondria

Advanced Imaging Techniques:

  • Use super-resolution microscopy to visualize Tim50's distribution relative to TOM and TIM23 complexes

  • Implement single-molecule tracking to follow precursor movement between complexes

  • Develop FRET-based reporters to monitor Tim50-precursor interactions in real-time

Recent research has revealed that Tim50 contains two domains that work together to coordinate translocation across both membranes. Methodologies that can distinguish between these domains' functions while preserving their coordinated action are particularly valuable for understanding the complex dynamics of mitochondrial protein import .

What are the most promising unexplored aspects of Tim50 biology for future research?

Several high-potential areas remain underexplored in Tim50 research:

Regulatory Mechanisms:

  • Investigation of post-translational modifications that may regulate Tim50 function

  • Identification of potential signaling pathways that modulate Tim50 activity during stress responses

  • Exploration of dynamic interactions with regulatory proteins outside the core import machinery

Disease Relevance:

  • Comprehensive characterization of human TIMM50 mutations and their impact on mitochondrial function

  • Investigation of TIMM50's role in neurodegenerative disorders with mitochondrial involvement

  • Exploration of connections between TIMM50 expression levels and metabolic diseases

Structural Biology Frontiers:

  • High-resolution structural analysis of the full-length Tim50 protein in a membrane environment

  • Structural characterization of dynamic Tim50 interactions with precursors during different stages of import

  • Mapping conformational changes in Tim50 upon presequence binding and release

Evolutionary Perspectives:

  • Comparative analysis of Tim50 across evolutionary distant organisms to identify ancestral features

  • Investigation of Tim50 adaptations in specialized cell types with unique mitochondrial demands

  • Exploration of Tim50 homologs in organisms with divergent mitochondrial import machineries

Therapeutic Applications:

  • Development of small molecules targeting Tim50 to enhance mitochondrial function in disease states

  • Engineering of Tim50-based tools for targeted delivery of therapeutic cargoes to mitochondria

  • Exploration of Tim50 modulation as a strategy for protecting against mitochondrial stress

Novel Techniques:

  • Implementation of in situ cryo-electron tomography to visualize Tim50 in its native environment

  • Development of optogenetic approaches to manipulate Tim50 function with spatiotemporal precision

  • Application of proximity labeling techniques to map the Tim50 interaction network under different conditions

These research directions promise to advance understanding of both fundamental mitochondrial biology and disease mechanisms, with potential translational implications.

How might synthetic biology approaches be utilized to engineer Tim50-based tools for mitochondrial research?

Synthetic biology offers innovative approaches to develop Tim50-based research tools:

Engineered Import Systems:

  • Design minimal synthetic import machines incorporating Tim50 and key partners

  • Create orthogonal import pathways by engineering Tim50 variants that recognize non-native signals

  • Develop inducible import systems using chemically controlled Tim50 variants

Biosensors and Reporters:

  • Engineer split-protein complementation systems where Tim50 reconstitutes a reporter protein upon presequence binding

  • Create FRET-based sensors using Tim50 PBD to monitor presequence interactions in real-time

  • Develop Tim50-based proximity sensors to track spatial relationships between translocase components

Modular Protein Design:

  • Create fusion proteins combining Tim50 domains with effector proteins for targeted mitochondrial manipulation

  • Design synthetic precursors with engineered interaction properties for Tim50

  • Develop protein scaffolds based on Tim50 for organizing functional components at the mitochondrial membranes

Recombinant Expression Strategies:

  • Optimize Y. lipolytica expression systems for producing designer Tim50 variants

  • Implement multi-vector transformation systems for co-expressing Tim50 with interaction partners

  • Utilize diploidization strategies to increase expression yields of engineered proteins

Implementation Methodology:

  • Identify the minimal functional domains of Tim50 through systematic truncation and mutation analysis

  • Establish structure-function relationships through biochemical and genetic complementation studies

  • Design and test synthetic Tim50 variants with altered specificity or novel functions

  • Validate engineered systems in both in vitro reconstitutions and cellular models

The heterologous expression capabilities of Y. lipolytica make it particularly suitable for implementing these synthetic biology approaches, as demonstrated by successful expression of multi-component enzyme systems using integrative transformation and diploidization strategies .

Such engineered Tim50-based tools would not only advance basic research on mitochondrial protein import but could also provide novel approaches for investigating and potentially treating mitochondrial dysfunction in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.