Recombinant Yarrowia lipolytica Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)

Shipped with Ice Packs
In Stock

Description

Molecular Overview and Production

Expression System:

  • Recombinant MRS2 is produced in Escherichia coli with an N-terminal His tag, enabling purification via affinity chromatography .

  • The mature protein spans residues 57–455 (UniProt ID: Q6C8H7) and is stored as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Domain Architecture:

  • MRS2 belongs to the CorA-MRS2-ALR superfamily, characterized by a conserved GMN motif (Gly-Met-Asn) critical for Mg²⁺ transport .

  • Cryo-EM structures reveal a homo-pentameric assembly with two transmembrane helices (TM1/TM2) and a large cytosolic domain .

Mechanism of Action:

  • Mediates Mg²⁺ influx into the mitochondrial matrix, essential for ATP synthesis, ribozyme function, and metabolic pathways .

  • Complements yeast mrs2 mutants, restoring Mg²⁺-dependent growth and mitochondrial RNA splicing .

Key Functional Findings:

  • Mg²⁺ Dependency: Growth retardation in Arabidopsis MRS2-7 mutants under low Mg²⁺ (50 μM) .

  • Transport Efficiency: High Mg²⁺ uptake rates observed in yeast mitochondrial assays .

  • Pathological Relevance: Knockdown disrupts mitochondrial metabolism and promotes cell death .

Research Applications

Experimental Use:

  • ELISA and Binding Studies: Commercial recombinant MRS2 is utilized for antibody development and protein interaction assays .

  • Structural Biology: Cryo-EM structures (e.g., 2.8 Å resolution) elucidate Mg²⁺ translocation mechanisms .

Biotechnological Relevance:

  • Y. lipolytica is a preferred host for recombinant protein expression due to its high secretory capacity and genetic tractability .

  • MRS2 serves as a model for studying Mg²⁺ transport dysregulation in metabolic diseases .

Future Directions

  • Therapeutic Targeting: Modulating MRS2 activity could address mitochondrial Mg²⁺ deficiency linked to neurodegenerative disorders .

  • Engineered Strains: Integration of MRS2 into multi-gene Y. lipolytica platforms for synthetic biology applications .

References Cited

- Commercial product specifications (Creative Biomart)
- Functional complementation in Arabidopsis (PMC2814501)
- Cryo-EM structures and gating mechanisms (Nature, 2023; Nature Structural & Molecular Biology, 2024)
- Regulatory role of the N-terminal domain (Life Science Alliance, 2023)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LPE10; YALI0D19514g; Mitochondrial inner membrane magnesium transporter LPE10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
57-455
Protein Length
Full Length of Mature Protein
Species
Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Target Names
LPE10
Target Protein Sequence
SPTKKPPSEVPTPTPGNYLVPITGPPGDTPRDTDLLIKSLTHKSLLPENNLVRCTVFDSD GNVTVASGEFKRTELLNKHGLLPRDLRKLDTGVNSIVPTILVRDNSILINLLHIRALIKA DKVLLFDVFGSTDSKTQSLFMYDLGHKLKKSNKTMGSLPYEMRALEAIFISVIAALDAEM KVHTTVINGILSELEQDIDREKLRHLLIQSKKLSAFLQKATLIRDVIDELLDTDEDLAGL YLTEKKAGHPRAIDDHSEVEMLLETYYKHCDEIVQTVGNLVSNIRNTEEIVNIILDANRN ALMHLDLKFQIGALGLAGGTFIASLYGMNLKNFIEESYWGFLGVTGVASLLTVWIIAHFL KSLRQVQRVTMTSDKKKAMKKKDTVAEKRRNHLRNWLTK
Uniprot No.

Target Background

Function
Recombinant *Yarrowia lipolytica* Mitochondrial inner membrane magnesium transporter mrs2 (MRS2) is a crucial protein for mitochondrial magnesium homeostasis. It modulates the conductance of the MRS2 channel and participates in the splicing of mitochondrial group II introns by influencing mitochondrial magnesium concentrations, which are essential for this splicing process.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MRS2 in Yarrowia lipolytica?

MRS2 (Mitochondrial RNA splicing protein 2) functions as a magnesium transporter located in the inner mitochondrial membrane. The protein contains two transmembrane domains that constitute a pore for Mg²⁺ entry into the mitochondrial matrix. In Yarrowia lipolytica, MRS2 is encoded by the MRS2 gene (YALI0D19514g) and consists of a 455 amino acid sequence .

The protein structure includes several key features:

  • N-terminal domain (NTD) that resides within the mitochondrial matrix

  • Two transmembrane domains forming the magnesium transport channel

  • Conserved GMN motif essential for magnesium selectivity

Unlike the pentameric assembly seen in bacterial ortholog CorA, research suggests that human MRS2 NTD self-associates into a homodimer, and this structural arrangement may be conserved in Yarrowia lipolytica . The protein plays a crucial role in maintaining mitochondrial magnesium homeostasis, which is essential for various mitochondrial functions including ATP synthesis and enzyme activities.

How does MRS2 regulation differ between yeast and human systems?

The regulatory mechanisms of MRS2 show both similarities and differences between yeast and human systems:

Regulatory AspectHuman MRS2Yarrowia lipolytica MRS2
Oligomeric stateHomodimeric NTDLikely homodimeric (based on homology)
Mg²⁺ feedback inhibitionNTD mediates autoregulationPresumed similar mechanism
Response to divalent cationsMg²⁺ and Ca²⁺ suppress oligomerizationNot specifically documented
Transcriptional regulationMultiple transcription factorsPart of the 87 TF-encoding genes deregulated during recombinant protein expression

Human MRS2 displays a negative feedback regulation mechanism mediated by its NTD. When matrix Mg²⁺ concentrations rise, binding to the NTD induces conformational changes that inhibit further transport . Although not explicitly characterized in Yarrowia lipolytica, functional conservation suggests similar regulatory mechanisms exist.

The transcriptional regulation of MRS2 in Yarrowia lipolytica likely involves multiple transcription factors, as studies have shown that recombinant protein expression significantly alters the expression of 87 transcription factor genes in this organism .

What are the essential experimental controls when working with recombinant MRS2 from Yarrowia lipolytica?

When conducting experiments with recombinant Yarrowia lipolytica MRS2, several essential controls should be implemented:

  • Expression verification controls:

    • Western blot analysis using antibodies against the protein or tag (e.g., His-tag)

    • Mass spectrometry validation of purified protein identity

    • RNA expression analysis (RT-qPCR) to confirm transcription

  • Functional controls:

    • Wild-type MRS2 expression in parallel with mutant constructs

    • MRS2 knockout strains as negative controls

    • Complementation assays to verify functional rescue

  • Purification quality controls:

    • SDS-PAGE with Coomassie staining to assess purity

    • Size exclusion chromatography to verify oligomeric state

    • Thermal stability assays to ensure proper folding

  • Species-specific considerations:

    • Codon optimization for Yarrowia lipolytica expression

    • Proper subcellular targeting verification using mitochondrial markers

    • Assessment of post-translational modifications using proteomics

The choice of expression system is critical, as functional studies of mitochondrial membrane proteins require proper insertion into lipid bilayers. For optimal expression of functional MRS2, inclusion of phospholipids (particularly phosphatidylcholine) during purification is recommended, as they have been shown to restore activity in other mitochondrial membrane proteins from Yarrowia lipolytica .

What experimental approaches can be used to study Mg²⁺ binding to MRS2 NTD?

Investigating Mg²⁺ binding to the MRS2 NTD requires sophisticated biophysical and biochemical techniques:

  • Isothermal Titration Calorimetry (ITC):

    • Provides direct measurement of binding affinity (Kd)

    • Determines thermodynamic parameters (ΔH, ΔS, ΔG)

    • Can be used to compare wild-type and mutant binding affinities

    • Has revealed approximately 7-fold decreased Mg²⁺ binding in human MRS2 NTD mutants

  • Fluorescence-based approaches:

    • Intrinsic tryptophan fluorescence to detect conformational changes

    • Fluorescent Mg²⁺ indicators to monitor transport activity

    • FRET-based assays using labeled MRS2 constructs to detect oligomerization changes

  • Structural biology techniques:

    • X-ray crystallography of the NTD with and without Mg²⁺

    • Cryo-EM analysis of full-length MRS2 in different conformational states

    • NMR spectroscopy to map Mg²⁺ binding sites and induced structural changes

  • Computational approaches:

    • Molecular dynamics simulations to predict Mg²⁺ binding sites

    • Homology modeling based on bacterial CorA structures

    • Molecular docking to identify potential binding pockets

  • Functional transport assays:

    • Reconstitution in liposomes with fluorescent Mg²⁺ indicators

    • Mitochondrial Mg²⁺ uptake assays using Mag-Fura-2 or similar indicators

    • Patch-clamp electrophysiology of reconstituted channels

Research has demonstrated that mutations in key residues of the human MRS2 NTD not only decrease Mg²⁺ binding affinity but also abolish Mg²⁺-induced changes in secondary, tertiary, and quaternary structures . Similar experimental approaches can be applied to study the Yarrowia lipolytica MRS2.

How can site-directed mutagenesis be applied to investigate MRS2 structure-function relationships?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in MRS2:

Strategic mutation targets:

  • Divalent cation binding sites:

    • Mutations in acidic residues (Asp, Glu) likely involved in Mg²⁺ coordination

    • Mutations in the NTD that affect autoregulation (based on homology to human MRS2)

    • Alterations to the conserved GMN motif critical for ion selectivity

  • Oligomerization interfaces:

    • Mutations at predicted dimer interfaces to disrupt self-association

    • Introduction of cysteine residues for disulfide cross-linking to trap specific conformations

    • Charge-reversal mutations to destabilize quaternary structure

  • Transmembrane domains:

    • Scanning mutagenesis of the pore-lining residues

    • Hydrophobicity alterations to affect membrane insertion

    • Introduction of bulky residues to probe channel dimensions

Experimental validation approaches:

  • Functional assessment:

    • Mitochondrial Mg²⁺ uptake measurements in wild-type and knockout cells expressing mutant constructs

    • Growth complementation assays in MRS2-deficient yeast strains

    • Electrophysiological measurements of channel activity

  • Structural assessment:

    • Circular dichroism to detect secondary structure changes

    • Limited proteolysis to probe conformational stability

    • Native gel electrophoresis to assess oligomeric state changes

  • Expression and localization verification:

    • Fluorescence microscopy with tagged constructs to confirm mitochondrial targeting

    • Western blotting of mitochondrial fractions to verify expression levels

    • Protease protection assays to confirm proper membrane topology

A particularly valuable approach would be to generate mutations analogous to those identified in human MRS2 that lead to gain-of-function phenotypes, as these could provide insight into the evolutionary conservation of regulatory mechanisms. Research has shown that disruption of NTD Mg²⁺ binding in human MRS2 potentiates mitochondrial Mg²⁺ uptake, identifying a negative feedback autoregulation mechanism .

What are the methodological considerations for optimizing recombinant MRS2 expression in Yarrowia lipolytica?

Optimizing recombinant MRS2 expression in Yarrowia lipolytica requires consideration of multiple factors:

Genetic elements and vector design:

  • Promoter selection:

    • Strong constitutive promoters (e.g., TEF, GPD) for high-level expression

    • Inducible promoters (e.g., POX2) for controlled expression

    • Hybrid promoters with enhanced activity for maximal yields

  • Codon optimization:

    • Adaptation to Yarrowia lipolytica codon usage bias

    • Avoidance of rare codons, especially in critical domains

    • Balanced GC content to enhance mRNA stability

  • Secretion and localization signals:

    • Native MRS2 mitochondrial targeting sequence

    • Optimized signal sequences for proper subcellular localization

    • Addition of epitope or affinity tags for detection and purification

Culture conditions optimization:

  • Media composition:

    • Carbon source selection (glucose, glycerol, oleic acid)

    • Nitrogen source optimization (peptone, yeast extract, ammonium sulfate)

    • Supplementation with magnesium and other cofactors

  • Growth parameters:

    • Temperature (typically 28-30°C for Yarrowia lipolytica)

    • pH optimization (typically pH 5.5-6.5)

    • Dissolved oxygen levels for proper mitochondrial function

  • Induction strategies:

    • Timing of induction relative to growth phase

    • Inducer concentration for controllable expression

    • Fed-batch strategies to maintain optimal nutrient levels

Transcriptional regulation engineering:
Recent research on Yarrowia lipolytica has revealed that manipulation of transcription factors (TFs) can significantly impact recombinant protein production. Of the 140 TFs identified in Yarrowia lipolytica, 87 are significantly deregulated during recombinant protein expression . Co-overexpression of specific TFs with the target protein can enhance yields, while knockout of repressive TFs may also improve expression.

A systematic approach involving the testing of different expression constructs, culture conditions, and host strain modifications is recommended to identify optimal conditions for each specific recombinant protein.

What purification strategies are most effective for isolating functional recombinant MRS2 from Yarrowia lipolytica?

Purification of functional MRS2 from Yarrowia lipolytica requires specialized approaches for membrane proteins:

Cell disruption and membrane preparation:

  • Gentle cell lysis:

    • Enzymatic digestion of cell wall (using lyticase or zymolyase)

    • Mechanical disruption via glass bead homogenization

    • Nitrogen cavitation for gentle membrane isolation

  • Mitochondrial isolation:

    • Differential centrifugation to separate mitochondria

    • Density gradient centrifugation for highly pure mitochondrial fractions

    • Mitoplast preparation by selective outer membrane disruption

  • Membrane protein solubilization:

    • Detergent screening (mild detergents like DDM, LMNG, or digitonin)

    • Lipid:protein ratio optimization during solubilization

    • Addition of stabilizing agents (glycerol, specific lipids)

Affinity purification approaches:

  • Tag-based strategies:

    • Hexa-histidine tagging for IMAC purification

    • Strep-tag II or FLAG tag for highly specific binding

    • Tandem affinity tags for increased purity

  • Chromatographic methods:

    • Ion exchange chromatography as secondary purification

    • Size exclusion chromatography for oligomeric state assessment

    • Hydrophobic interaction chromatography for membrane protein separation

Protein stabilization and functional preservation:

  • Lipid supplementation:

    • Addition of phosphatidylcholine (400-500 molecules per complex) has been shown to reactivate Yarrowia lipolytica mitochondrial proteins

    • Reconstitution into nanodiscs or liposomes for functional studies

    • Bicelle formation for structural studies

  • Buffer optimization:

    • Inclusion of Mg²⁺ at physiological concentrations

    • pH optimization based on mitochondrial matrix pH

    • Ionic strength adjustment for oligomeric stability

  • Storage considerations:

    • Flash freezing in liquid nitrogen with cryoprotectants

    • Storage at -80°C in presence of glycerol (50%)

    • Aliquoting to avoid repeated freeze-thaw cycles

The purification strategy should be validated by assessing protein functionality through magnesium transport assays, structural integrity analysis, and binding studies.

How can the impact of MRS2 mutations on magnesium transport be quantitatively assessed?

Quantitative assessment of MRS2-mediated magnesium transport requires multiple complementary approaches:

In vitro transport assays:

  • Liposome-based assays:

    • Reconstitution of purified MRS2 into liposomes

    • Loading of liposomes with fluorescent Mg²⁺ indicators (Mag-Fura-2, Magnesium Green)

    • Measurement of Mg²⁺ influx kinetics using stopped-flow spectrofluorometry

    • Determination of transport parameters (Vmax, Km) for different mutants

  • Electrophysiological methods:

    • Planar lipid bilayer recordings of reconstituted MRS2

    • Patch-clamp analysis of giant liposomes containing MRS2

    • Measurement of channel conductance, open probability, and ion selectivity

Cellular transport assays:

  • Mitochondrial Mg²⁺ measurements:

    • Expression of MRS2 variants in MRS2-knockout cells

    • Loading of cells with mitochondrially-targeted Mg²⁺ indicators

    • Real-time confocal microscopy to monitor Mg²⁺ uptake kinetics

    • Flow cytometry for population-level analysis

  • Isolated mitochondria studies:

    • Preparation of mitochondria from cells expressing MRS2 variants

    • Measurement of Mg²⁺ uptake using membrane-impermeable indicators

    • Analysis of respiratory chain activity as a functional readout

    • Assessment of mitochondrial membrane potential correlation with Mg²⁺ transport

Binding and structural analyses:

  • Mg²⁺ binding assays:

    • Isothermal titration calorimetry to determine binding affinity changes

    • Fluorescence-based binding assays using intrinsic or extrinsic fluorophores

    • Equilibrium dialysis with radioactive ²⁸Mg²⁺

  • Structural impact assessment:

    • Circular dichroism to detect secondary structure changes upon Mg²⁺ binding

    • Limited proteolysis to identify conformational changes

    • Native gel electrophoresis to assess oligomeric state alterations

A comprehensive approach would involve:

  • Expressing wild-type and mutant MRS2 in Yarrowia lipolytica

  • Purifying the proteins and reconstituting them into liposomes

  • Performing parallel transport assays using multiple methodologies

  • Correlating transport activity with structural changes and binding parameters

Research has shown that disruption of Mg²⁺ binding to the NTD of human MRS2 potentiates mitochondrial Mg²⁺ uptake in both wild-type and MRS2 knockout cells, suggesting this domain plays a critical role in autoregulation . Similar experimental approaches could be applied to Yarrowia lipolytica MRS2.

What techniques can be used to investigate the interaction between MRS2 and other mitochondrial proteins?

Investigating MRS2 interactions with other mitochondrial proteins requires specialized approaches for membrane protein complexes:

Affinity-based interaction identification:

  • Co-immunoprecipitation (Co-IP):

    • Antibody-based pulldown of tagged MRS2

    • Western blot analysis of co-precipitated proteins

    • Mass spectrometry identification of novel interaction partners

  • Proximity labeling techniques:

    • BioID or TurboID fusion to MRS2 for in vivo biotinylation of proximal proteins

    • APEX2 fusion for proximity-dependent protein labeling

    • Mass spectrometry analysis of biotinylated proteins

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of intact mitochondria

    • Digestion and enrichment of crosslinked peptides

    • Mass spectrometry identification of interaction interfaces

Real-time interaction monitoring:

  • Förster resonance energy transfer (FRET):

    • Expression of fluorescently tagged MRS2 and candidate partners

    • Live-cell imaging of interaction dynamics

    • Spectroscopic analysis of FRET efficiency

  • Bioluminescence resonance energy transfer (BRET):

    • Luciferase fusion for donor emission

    • Reduced background compared to fluorescence approaches

    • Suitable for real-time monitoring in intact cells

  • Split reporter systems:

    • BiFC (Bimolecular Fluorescence Complementation)

    • Split luciferase complementation

    • Protein-fragment complementation assays (PCA)

Functional interaction assessment:

  • Genetic interaction analysis:

    • Synthetic lethality/sickness screening

    • Suppressor screening to identify functional partners

    • Double knockout/knockdown phenotypic analysis

  • Metabolic profiling:

    • Analysis of changes in mitochondrial metabolism

    • Measurement of respiration rates in single and double mutants

    • Assessment of mitochondrial membrane potential

  • Proteomics approaches:

    • Quantitative proteomics of wild-type vs. MRS2 mutant mitochondria

    • Analysis of protein complex assembly by blue native PAGE

    • Correlation of MRS2 levels with other mitochondrial proteins

Yarrowia lipolytica offers unique advantages for studying these interactions due to its obligate aerobic metabolism and well-developed genetic tools. The species contains complexes I-IV of the respiratory chain, making it an excellent model for studying mitochondrial protein interactions . Genetic manipulation techniques, including deletion strain generation and complementation with plasmids carrying the deleted gene, provide powerful tools for functional interaction studies.

What strategies can address poor expression or mislocalization of recombinant MRS2 in Yarrowia lipolytica?

Poor expression or mislocalization of recombinant MRS2 in Yarrowia lipolytica can be addressed through systematic troubleshooting:

Expression optimization strategies:

  • Vector and promoter adjustments:

    • Testing different promoter strengths (TEF, GPD, POX)

    • Optimizing the Kozak sequence for improved translation initiation

    • Using intron-containing constructs to enhance mRNA processing

  • Codon optimization approaches:

    • Full codon optimization for Yarrowia lipolytica

    • Targeted optimization of rare codons in problematic regions

    • Elimination of potential cryptic splice sites

  • Protein stabilization strategies:

    • Co-expression with molecular chaperones (HSP70, HSP90)

    • Inclusion of fusion partners to enhance solubility

    • Expression as truncated domains for structural studies

Localization improvement approaches:

  • Targeting sequence optimization:

    • Using the native Yarrowia lipolytica MRS2 mitochondrial targeting sequence

    • Testing different N-terminal targeting sequences from well-characterized mitochondrial proteins

    • Creating chimeric targeting sequences with enhanced import efficiency

  • Import machinery considerations:

    • Co-expression of components of the mitochondrial protein import machinery

    • Optimization of growth conditions to maintain mitochondrial membrane potential

    • Modulation of cellular energetics to support mitochondrial protein import

  • Visualization strategies:

    • C-terminal fluorescent protein fusions to monitor localization

    • Split GFP approach for minimally invasive tagging

    • Immunofluorescence microscopy with antibodies against tags or the protein itself

Strain engineering approaches:
Recent research has identified that transcription factors play a significant role in recombinant protein expression in Yarrowia lipolytica. Of the 140 TFs in this yeast, 87 were significantly deregulated during recombinant protein expression . Strategic overexpression or knockout of specific TFs could enhance MRS2 expression. Additionally, engineering strains with enhanced mitochondrial content or altered mitochondrial dynamics may improve expression of mitochondrial membrane proteins.

A systematic approach investigating multiple variables simultaneously (e.g., using design of experiments methodology) can efficiently identify optimal conditions for recombinant MRS2 expression and localization.

How can researchers distinguish between direct and indirect effects when studying MRS2 function in Yarrowia lipolytica?

Distinguishing direct from indirect effects in MRS2 functional studies requires careful experimental design:

Genetic approaches for causality determination:

  • Rescue experiments:

    • Complementation of MRS2 knockout with wild-type or mutant variants

    • Use of orthologous MRS2 proteins from other species

    • Expression of engineered MRS2 variants with altered regulation

  • Temporal control systems:

    • Inducible expression systems to monitor acute effects

    • Degron-tagged MRS2 for rapid protein depletion

    • Optogenetic control of MRS2 activity or expression

  • Domain-specific mutations:

    • Separation-of-function mutations that affect specific aspects of MRS2 function

    • Structure-guided mutations targeting different functional domains

    • Systematic alanine scanning to map functional surfaces

Biochemical approaches for direct interaction assessment:

  • In vitro reconstitution:

    • Purified component systems to test direct effects

    • Stepwise addition of components to identify minimal required factors

    • Comparison of activities in defined versus complex systems

  • Direct binding assays:

    • Surface plasmon resonance to measure direct interactions

    • Microscale thermophoresis for solution-based interaction studies

    • Isothermal titration calorimetry for thermodynamic characterization

  • Proximity labeling with spatial resolution:

    • Targeted enzymatic tagging (BioID, APEX) fused to specific MRS2 domains

    • Split enzymatic systems requiring direct protein interaction

    • Quantitative analysis of labeling efficiency as measure of proximity

Physiological approaches for functional context:

  • Multi-parameter phenotyping:

    • Parallel measurement of multiple mitochondrial parameters

    • Time-resolved analysis to establish cause-effect relationships

    • Dosage-dependent studies to establish thresholds

  • Metabolic flux analysis:

    • 13C metabolic flux analysis to track metabolic changes

    • Correlation analysis between Mg²⁺ levels and metabolic pathways

    • Mathematical modeling to predict direct versus indirect effects

  • Comparative studies across conditions:

    • Analysis under different nutrient conditions

    • Comparison of effects in fermentative versus respiratory growth

    • Temperature-dependent phenotypes to distinguish enzymatic from structural roles

Research has shown that MRS2 NTD mutations in human cells potentiate mitochondrial Mg²⁺ uptake, demonstrating direct regulation . Similar experimental frameworks applied to Yarrowia lipolytica MRS2 would help establish evolutionary conservation of these direct regulatory mechanisms.

What controls are essential when comparing wild-type and mutant MRS2 function in transport assays?

When comparing wild-type and mutant MRS2 function in transport assays, several essential controls must be included:

Expression and localization controls:

  • Protein level verification:

    • Western blotting of whole cell lysates, mitochondrial fractions, and purified protein

    • Quantitative assessment of expression levels with appropriate loading controls

    • Flow cytometry of tagged constructs for population distribution analysis

  • Subcellular localization confirmation:

    • Immunofluorescence microscopy with mitochondrial markers

    • Subcellular fractionation with Western blot analysis

    • Protease protection assays to confirm membrane topology

  • Membrane insertion verification:

    • Carbonate extraction to distinguish peripheral from integral membrane proteins

    • Detergent solubility profiles to assess membrane integration

    • Limited proteolysis to probe accessibility of domains

Functional controls:

  • Positive and negative transport controls:

    • Parallel assays with known functional and non-functional MRS2 variants

    • Inclusion of specific MRS2 inhibitors when available

    • Ionophore controls for maximum transport capability

  • Ion selectivity controls:

    • Parallel assays with other divalent cations (Ca²⁺, Mn²⁺, Co²⁺)

    • Competition experiments between Mg²⁺ and other ions

    • Assessment of transport in presence of chelators with different affinities

  • Energetic state controls:

    • Measurements with and without respiratory substrates

    • Membrane potential dissipation controls (CCCP, valinomycin)

    • ATP depletion to assess energy dependence

Experimental design controls:

  • Technical replicates:

    • Multiple measurements from the same biological preparation

    • Statistical analysis of measurement variance

    • Instrument calibration with standard solutions

  • Biological replicates:

    • Independent preparations from separate cultures

    • Multiple clones of the same construct

    • Experiments performed on different days

  • Dose-response relationships:

    • Varying external Mg²⁺ concentrations to determine Km and Vmax

    • Protein expression level titration to assess stoichiometric effects

    • Inhibitor concentration gradients for IC50 determination

Data analysis considerations:

  • Normalization approaches:

    • Normalization to protein expression levels

    • Correction for mitochondrial content differences

    • Standardization based on maximum transport capacity

  • Kinetic parameter extraction:

    • Initial rate measurements versus equilibrium assessments

    • Curve fitting to appropriate transport models

    • Statistical comparison of derived parameters

  • Multi-parameter analysis:

    • Correlation between transport activity and structural parameters

    • Integration of transport data with other functional readouts

    • Principal component analysis for complex phenotypic data

Research has shown that disruption of Mg²⁺ binding to the NTD of human MRS2 potentiates mitochondrial Mg²⁺ uptake, highlighting the importance of careful controls when interpreting functional changes . Similar experimental rigor applied to Yarrowia lipolytica MRS2 studies would ensure reliable and reproducible results.

What emerging technologies could advance our understanding of MRS2 function in Yarrowia lipolytica?

Several cutting-edge technologies hold promise for advancing MRS2 research:

Advanced structural biology approaches:

  • Cryo-electron microscopy advancements:

    • Single-particle analysis of MRS2 in different conformational states

    • Cryo-electron tomography of MRS2 in native mitochondrial membranes

    • Time-resolved structures capturing transport dynamics

  • Integrative structural biology:

    • Combination of X-ray crystallography, cryo-EM, and NMR data

    • Molecular dynamics simulations constrained by experimental data

    • Cross-linking mass spectrometry to validate predicted interfaces

  • In situ structural determination:

    • Cryo-focused ion beam milling of intact mitochondria

    • Correlative light and electron microscopy of tagged MRS2

    • Visual proteomics approaches for contextual structural information

Functional imaging innovations:

  • Genetically encoded Mg²⁺ sensors:

    • Development of mitochondrially targeted Mg²⁺ indicators

    • Ratiometric sensors for quantitative measurements

    • FRET-based sensors for local Mg²⁺ concentration monitoring

  • Super-resolution microscopy:

    • STED or STORM imaging of MRS2 distribution within mitochondria

    • Single-molecule tracking to monitor dynamics

    • Multi-color imaging to correlate with other mitochondrial proteins

  • Label-free imaging techniques:

    • Stimulated Raman scattering microscopy for metabolic imaging

    • Nano-infrared spectroscopy for chemical composition analysis

    • Mass spectrometry imaging for spatial metabolomics

Genetic and genomic technologies:

  • CRISPR-based approaches:

    • Base editing for precise point mutations

    • CRISPRi/CRISPRa for tunable expression control

    • CRISPR screening for genetic interactors

  • Synthetic biology strategies:

    • De novo design of MRS2 variants with altered properties

    • Engineering orthogonal Mg²⁺ transport systems

    • Creation of synthetic genetic circuits for controlled expression

  • Multi-omics integration:

    • Combined proteomics, metabolomics, and transcriptomics analysis

    • Systems biology modeling of Mg²⁺ homeostasis networks

    • Machine learning approaches to predict functional outcomes

These emerging technologies would significantly enhance our understanding of MRS2 structure, function, and regulation in Yarrowia lipolytica, potentially revealing novel aspects of mitochondrial magnesium transport mechanisms and their evolutionary conservation across species.

How might understanding MRS2 function in Yarrowia lipolytica contribute to broader mitochondrial biology research?

Research on MRS2 in Yarrowia lipolytica has significant potential to advance multiple areas of mitochondrial biology:

Evolutionary insights into mitochondrial ion transport:

  • Comparative studies across species:

    • Identification of conserved versus divergent features in MRS2 structure and function

    • Adaptation of magnesium transport to different cellular contexts

    • Evolution of regulatory mechanisms for mitochondrial ion homeostasis

  • Ancestral reconstruction approaches:

    • Inference of primordial MRS2 properties

    • Experimental testing of evolutionary hypotheses

    • Understanding selective pressures on mitochondrial magnesium transport

  • Horizontal gene transfer exploration:

    • Assessment of bacterial influences on eukaryotic magnesium transport

    • Comparative analysis of prokaryotic CorA and eukaryotic MRS2

    • Reconstruction of evolutionary trajectories for mitochondrial ion channels

Metabolic regulation mechanisms:

  • Magnesium as a metabolic regulator:

    • Role of Mg²⁺ in controlling mitochondrial enzyme activities

    • Coordination between Mg²⁺ homeostasis and energy metabolism

    • Integration of ion transport with respiratory chain function

  • Stress response pathways:

    • MRS2 function under different metabolic and environmental stresses

    • Adaptation of magnesium transport to changing cellular demands

    • Role in maintaining mitochondrial integrity during stress

  • Signaling networks:

    • Interplay between mitochondrial and cytosolic magnesium pools

    • Cross-talk between magnesium and calcium signaling pathways

    • Integration of mitochondrial ion transport with nuclear gene expression

Biotechnological applications:

  • Yarrowia lipolytica as a production platform:

    • Engineering magnesium homeostasis for optimal protein production

    • Enhancement of mitochondrial function for metabolic engineering

    • Development of Yarrowia lipolytica as a model for mitochondrial disease studies

  • Mitochondrial medicine implications:

    • Identification of therapeutic targets for mitochondrial disorders

    • Development of small-molecule modulators of magnesium transport

    • Creation of disease models for testing interventions

  • Synthetic biology opportunities:

    • Design of artificial magnesium-responsive genetic circuits

    • Engineering of novel ion selectivity in transport proteins

    • Development of biosensors for mitochondrial magnesium

Yarrowia lipolytica offers unique advantages as a model system due to its obligate aerobic metabolism and well-developed genetic tools . As an oleaginous yeast with industrial importance, insights gained from MRS2 research could have implications beyond basic science, potentially informing applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.